SecReT6
Effector Protein ID: 332715413
-
SecReT6 ID438
T6SS typeA5
Gene symbol-
Locus tagAGROH133_09370
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]37890..38390 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorAtu4347
DescriptionTae
UniProt IDF0LDA2
KEGG IDagr:AGROH133_09370
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 5.20E-21, Aligned region: 41..158
Protein Sequence: 166 a.a.     [Download]
>gi|332715413|ref|YP_004442879.1| hypothetical protein AGROH133_09370 [Agrobacterium sp. H13-3]
MRVNFDTLYKNYPSSDPSHPNYVSQRDLFTEIGWDDFIGNPNYHNTCAIRVSIAFVKSGINIVPASHRIQ
KGPYAGKGIEVNMRRLANLVKRTSYLGEPEPFTPATARNGIGARNGVVAFNNIPGYTGGGHIDLVRGGSE
ATQCASACYYNSETIWFWPLQSSRGS
-
Nucleotide Sequence: 501 bp     [Download]
>gi|332715374|ref|NC_015508.1|:c38390-37890 Agrobacterium sp. H13-3 chromosome linear, complete sequence
ATGCGCGTTAACTTTGACACTCTTTATAAGAATTATCCGAGCAGCGACCCGTCGCACCCGAACTATGTCA
GCCAGCGTGATCTTTTCACGGAAATAGGCTGGGATGATTTTATCGGTAACCCGAACTATCACAATACCTG
TGCCATCCGCGTTAGCATCGCTTTCGTGAAATCGGGGATCAACATCGTGCCAGCCTCGCATCGCATCCAG
AAAGGTCCATATGCGGGCAAGGGCATTGAGGTGAACATGCGCCGCCTCGCAAATCTGGTGAAACGGACGA
GCTATCTAGGCGAGCCCGAACCGTTTACCCCCGCGACAGCGCGTAATGGCATCGGTGCCCGTAACGGTGT
TGTGGCGTTCAACAATATCCCTGGTTACACCGGAGGCGGCCATATCGATCTTGTGCGGGGTGGCTCAGAG
GCCACCCAATGCGCGTCGGCCTGCTACTACAATTCGGAAACGATCTGGTTCTGGCCACTTCAGTCCAGCC
GCGGGTCCTGA