SecReT6
Effector Protein ID: 332715415
-
SecReT6 ID438
T6SS typeA5
Gene symbol-
Locus tagAGROH133_09373
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]38900..39376 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorAtu4345
DescriptionHcp protein
UniProt IDF0LDA4
KEGG IDagr:AGROH133_09373
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.40E-32, Aligned region: 4..134
Protein Sequence: 158 a.a.     [Download]
>gi|332715415|ref|YP_004442881.1| hypothetical protein AGROH133_09373 [Agrobacterium sp. H13-3]
MPIYLQIDGIQGDATHEEHRKWMDIEAIHWNVARNMNTSAGSAANREASEPTISEVILTKVSDSSSTKLF
QEACAGRTGKLATIHLVTTGNPGNTYIEYLLTNTLIASYSVDSSGDRPVETVKLNFTKMEVKYTPFDDNN
SPQSPMIASYDLATTKAA
-
Nucleotide Sequence: 477 bp     [Download]
>gi|332715374|ref|NC_015508.1|:c39376-38900 Agrobacterium sp. H13-3 chromosome linear, complete sequence
ATGCCAATTTATCTGCAGATTGACGGTATCCAGGGCGACGCCACCCATGAAGAACATCGCAAGTGGATGG
ATATTGAAGCCATTCACTGGAACGTGGCCCGCAACATGAACACCTCTGCTGGTTCTGCTGCAAACCGCGA
GGCATCCGAACCGACCATTTCGGAAGTCATTCTGACCAAGGTTAGCGATTCTTCTTCCACCAAGCTTTTC
CAGGAAGCCTGCGCCGGCCGGACCGGCAAGCTCGCAACCATTCATCTGGTGACCACGGGTAATCCCGGCA
ACACCTATATCGAGTATCTGCTGACAAACACGCTTATCGCCAGCTACTCGGTGGATTCCAGCGGTGACCG
TCCGGTGGAAACCGTCAAGCTCAACTTCACGAAGATGGAAGTGAAGTACACGCCGTTCGACGACAACAAC
TCGCCGCAGTCTCCGATGATCGCCTCCTACGATCTGGCGACGACGAAGGCTGCCTGA