SecReT6
Effector Protein ID: 333898455
-
SecReT6 ID439
T6SS typeA3
Gene symbol-
Locus tagPsefu_0250
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]283155..283643 [-]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorPA0085
DescriptionHcp protein
UniProt IDF6AF36
KEGG IDpfv:Psefu_0250
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.80E-46, Aligned region: 6..136
Protein Sequence: 162 a.a.     [Download]
>gi|333898455|ref|YP_004472328.1| type VI secretion system effector [Pseudomonas fulva 12-X]
MAVDMFIKIGDVKGESKDKAHADEIDVLAWSWGMSQSGSMHVGGGGGAGKVNIQDLSLTKYVDKSSPNLM
MACSSGKHYPEAKLTVRKAGGDSQVEYLIITLKEVLVSSISTGGSGGEDRLTENVTLNFAQVLVDYQPQK
ADGAKDGGPVKYGWNIRQNVKV
-
Nucleotide Sequence: 489 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c283643-283155 Pseudomonas fulva 12-X chromosome, complete genome
ATGGCTGTTGATATGTTCATCAAGATTGGCGACGTCAAGGGTGAGTCCAAGGACAAGGCCCACGCTGACG
AAATCGACGTACTGGCCTGGAGCTGGGGCATGAGCCAGTCCGGCTCCATGCACGTCGGCGGTGGCGGCGG
TGCCGGCAAGGTCAATATCCAGGATCTGTCGCTGACCAAGTACGTCGACAAGTCCAGCCCCAACCTGATG
ATGGCCTGCTCCAGCGGCAAGCATTATCCGGAAGCCAAGCTGACCGTCCGCAAGGCCGGCGGCGACTCAC
AGGTCGAGTACCTGATCATCACCCTGAAGGAAGTGCTGGTGTCGTCCATCAGCACCGGCGGCAGCGGTGG
CGAAGATCGCCTGACCGAGAACGTCACCCTGAACTTCGCTCAGGTGCTGGTCGACTACCAGCCGCAGAAA
GCCGACGGCGCCAAAGACGGCGGCCCGGTCAAATACGGCTGGAACATCCGCCAGAACGTCAAGGTGTAA