SecReT6
Effector Protein ID: 333902541
-
SecReT6 ID439
T6SS typeA3
Gene symbol-
Locus tagPsefu_4368
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]4768783..4771008 [+]
ProductImpA family type VI secretion-associated protein
Effector typeProtein
Homologous effectorPA0095
Descriptiontype VI secretion system Vgr family protein
UniProt IDF6AA93
KEGG IDpfv:Psefu_4368
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.10E-90, Aligned region: 29..330
Phage_base_V [PF04717], Evalue: 1.70E-25, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 2.30E-24, Aligned region: 514..533
Gp5_C [PF06715], Evalue: 2.30E-24, Aligned region: 530..552
Gp5_C [PF06715], Evalue: 2.30E-24, Aligned region: 554..576
Gp5_C [PF06715], Evalue: 2.30E-24, Aligned region: 578..600
Gp5_C [PF06715], Evalue: 2.30E-24, Aligned region: 594..616
Gp5_C [PF06715], Evalue: 2.30E-24, Aligned region: 617..637
Gp5_C [PF06715], Evalue: 2.30E-24, Aligned region: 641..661
Protein Sequence: 741 a.a.     [Download]
>gi|333902541|ref|YP_004476414.1| ImpA family type VI secretion-associated protein [Pseudomonas fulva 12-X]
MAITQQSRMAKVNSPLGENALVMERLAGNESLGRLFHYELSLASENSSLKLNALLGKPMGLAVQLADGSD
RYFHGIVARCSQTAHRGQFASYQVTLKPWLWLLSRTSDCRIFQSKTVPDIVKQVFRDLGFSDFEDALTRS
YREWDYCVQYRETSFDFVSRLMEQEGIYYYFRHEQERHVLVLCDAYGAHSTAPGYGRVPFYPLDDQMRER
DHIHDWHLAHEVQPGSLALNDYDFQRPSARLEVRSSIAREHANADYPLYDYPGEYVQSKDGEQYARNRIE
AIQAQYEQIRLKGNARGLGSGHLFSLTDYPRDDQNREYLIVDAEYTITQDLYESGRGSESFQFDSSLTCI
DASQVFRPLPLTVQPIVQGPQTAMVVGPKGEEIWTDQYGRVKVHFYWDRHDQSNENSSCWIRVSQNWAGK
NWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPANATQSGTKSRSSKGGTPANFNEIRM
EDKKGEEQLFIHAEKNQDIEVENDETHWVGHDRTKTIDNDETVHVKHDRTETVDNNETITIGVDRTEKVG
NNESITIGVNRSEKVGSNETIAIGANRTETVGSDETISIGANRTESVGSNETISIGANRTESVGNNERTT
IGADRTALITANEYVLVGADQANMVGGNESHYVRGERNSRVLKDDNLHVGKNFVLKAGDSITLQTGAASI
VMKKDGTIVIRGKNISIDGSGAINVKAAKNIVMKGQKILQN
-
Nucleotide Sequence: 2226 bp     [Download]
>gi|333898208|ref|NC_015556.1|:4768783-4771008 Pseudomonas fulva 12-X chromosome, complete genome
ATGGCAATCACACAACAGTCGCGCATGGCCAAGGTCAACAGCCCGCTCGGCGAAAACGCGCTGGTGATGG
AGCGCCTGGCCGGCAACGAATCCCTGGGCCGCCTGTTCCACTACGAGCTCAGCCTGGCCTCGGAAAACTC
CTCGCTCAAGCTCAATGCCCTGCTCGGCAAGCCCATGGGCCTGGCCGTGCAACTGGCCGACGGCAGCGAC
CGCTACTTCCACGGCATCGTCGCGCGCTGCAGCCAGACCGCCCACCGCGGCCAGTTCGCCAGCTATCAGG
TCACCCTCAAGCCCTGGTTATGGCTGCTGTCGCGCACCTCCGACTGCCGCATCTTCCAGAGCAAGACGGT
GCCGGACATCGTCAAGCAGGTGTTCCGCGACCTGGGTTTCTCGGACTTCGAAGACGCCCTGACCCGCTCC
TACCGCGAGTGGGACTATTGCGTGCAGTATCGCGAGACCAGCTTCGATTTCGTCAGCCGGCTGATGGAGC
AGGAAGGCATCTACTACTACTTCCGCCACGAGCAGGAGCGCCATGTGCTGGTGCTCTGCGATGCCTATGG
TGCCCACAGCACGGCGCCCGGATATGGGCGCGTGCCCTTCTATCCGCTCGACGACCAGATGCGCGAGCGT
GACCACATCCACGACTGGCACCTGGCCCACGAGGTGCAGCCCGGCTCCCTGGCGCTCAACGACTACGACT
TCCAGCGCCCCAGCGCACGCCTGGAAGTGCGCTCCAGCATCGCCCGCGAGCACGCCAACGCCGATTATCC
GCTCTACGACTACCCGGGCGAGTACGTGCAGAGCAAGGACGGCGAGCAGTACGCGCGCAATCGCATCGAG
GCGATCCAGGCGCAGTACGAGCAGATCCGCCTGAAGGGCAATGCCCGAGGCCTGGGCAGCGGGCACCTGT
TCAGCCTTACCGATTACCCGCGCGACGATCAGAACCGCGAGTACCTGATCGTCGATGCCGAATACACCAT
CACCCAGGATCTCTACGAAAGCGGCCGCGGCAGCGAGAGCTTCCAGTTCGACAGCAGCCTGACCTGCATC
GACGCCAGCCAGGTGTTCCGCCCGCTGCCGCTGACCGTGCAGCCCATCGTGCAGGGCCCGCAGACGGCCA
TGGTGGTCGGCCCGAAGGGCGAGGAAATCTGGACCGACCAGTACGGCCGCGTGAAGGTGCACTTCTACTG
GGACCGCCACGACCAATCCAACGAGAACAGCTCGTGCTGGATTCGCGTGTCGCAGAACTGGGCCGGCAAG
AACTGGGGCTCGATTCAGATTCCGCGCATCGGCCAGGAAGTGATCGTCAGCTTTCTGGAGGGCGACCCCG
ACCGGCCGATCATCACCGGCCGCGTCTACAACGCCGAGCAGACGGTGCCCTACGACCTGCCCGCCAACGC
CACGCAAAGCGGCACCAAGAGCCGCTCGAGCAAGGGTGGCACGCCGGCCAACTTCAACGAAATCCGCATG
GAAGACAAGAAGGGCGAAGAGCAGCTGTTCATCCATGCCGAGAAGAACCAGGACATCGAGGTTGAGAACG
ACGAGACCCACTGGGTCGGCCACGACCGCACCAAGACCATCGACAACGACGAAACGGTGCACGTCAAACA
CGACCGCACCGAGACGGTGGACAACAACGAGACCATCACCATCGGCGTCGATCGTACCGAAAAGGTCGGC
AACAACGAGTCCATCACCATCGGCGTGAACCGCAGCGAGAAGGTCGGCAGCAACGAGACCATCGCCATCG
GCGCCAACCGTACCGAGACCGTCGGCAGCGATGAAACCATCAGCATCGGCGCCAACCGCACCGAGAGCGT
GGGCAGCAACGAAACCATCAGCATCGGCGCCAACCGCACCGAAAGCGTCGGCAACAACGAGCGCACCACC
ATCGGTGCCGACCGCACCGCGCTGATCACTGCCAACGAGTACGTGCTCGTCGGTGCAGACCAGGCGAACA
TGGTGGGCGGCAACGAGTCGCACTATGTGCGTGGCGAGCGCAACAGCCGCGTCCTCAAGGATGACAATCT
GCATGTCGGCAAGAACTTCGTGCTCAAGGCCGGCGACTCGATCACCCTGCAGACCGGCGCTGCCAGCATC
GTCATGAAGAAGGACGGCACCATCGTCATTCGTGGCAAGAACATCAGCATCGACGGCTCCGGGGCGATCA
ACGTCAAGGCCGCCAAGAACATCGTGATGAAAGGCCAGAAGATCCTGCAGAACTAG