SecReT6
Effector Protein ID: 333908845
-
SecReT6 ID441
T6SS typeA1
Gene symbol-
Locus tagMar181_2479
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2726124..2726642 [-]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDF6CWW7
KEGG IDmpc:Mar181_2496, mpc:Mar181_2479
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-35, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|333908845|ref|YP_004482431.1| type VI secretion system effector [Marinomonas posidonica IVIA-Po-181]
MPTPCYISIQGETQGLITAGAMTVDSTGEIGLEGHEDEMLVQQFLHNVTVPTNPQSGSPSGKRVHKPFKF
TVALNKAVPLLYNALSAGEKLSNVELKWYRTSSEGKQENFFTTSLEGAVIVDIECEMPHCLDPSNESFTQ
NLTVSLAYRKITWDHVSSGTSGADDWTQPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>ref|NC_015559.1|:c2726642-2726124 type VI secretion system effector [Marinomonas posidonica IVIA-Po-181]
ATGCCAACGCCGTGTTATATTTCGATTCAAGGGGAAACACAGGGACTGATTACTGCTGGTGCCATGACAG
TGGATTCTACTGGTGAAATCGGTTTGGAAGGTCACGAAGATGAAATGCTAGTACAACAGTTCTTGCATAA
TGTCACCGTACCAACGAACCCACAATCAGGTAGCCCATCTGGTAAACGTGTTCACAAACCGTTTAAATTC
ACCGTGGCTCTAAACAAAGCCGTACCATTACTTTACAACGCCTTGTCTGCCGGTGAAAAACTGTCAAATG
TGGAATTGAAATGGTACCGCACGTCTTCTGAAGGCAAGCAAGAAAACTTCTTCACAACCTCATTAGAAGG
TGCTGTGATTGTGGACATCGAATGCGAAATGCCACACTGCCTAGACCCATCTAATGAGTCTTTCACACAG
AACTTAACAGTATCCCTTGCGTATCGTAAAATCACTTGGGATCATGTTTCTTCTGGAACATCTGGTGCGG
ATGATTGGACTCAACCAATCGAAGCCTAA