SecReT6
Effector Protein ID: 333985114
-
SecReT6 ID443
T6SS typeA3
Gene symbol-
Locus tagMetme_3457
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]3824035..3824514 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2702
DescriptionTse2
UniProt IDG0A731
KEGG IDmmt:Metme_3457
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 159 a.a.     [Download]
>gi|333985114|ref|YP_004514324.1| unnamed protein product [Methylomonas methanica MC09]
MSYDYEKTSIDLYRAIFKGNFTTDVSCYLKPDKDLADADSIAPILHPTFSELSGEGALRRPPDIIANPDT
GMYDPDTGGTSVFNRPRVLRRAEGDFFIPSGTDIPPDLKVKKDSYNERLKATHYTIMPLKPMFKESLMGQ
LDNFVRNAIRRQYEKARGL
-
Nucleotide Sequence: 480 bp     [Download]
>gi|333981747|ref|NC_015572.1|:c3824514-3824035 Methylomonas methanica MC09 chromosome, complete genome
ATGAGTTATGACTATGAAAAAACGAGTATTGACCTCTATCGCGCAATATTTAAGGGGAATTTCACAACGG
ATGTAAGTTGTTATCTGAAACCGGACAAGGATTTAGCGGACGCAGACTCAATAGCACCAATTCTCCATCC
AACTTTTAGCGAGCTATCAGGAGAGGGGGCGCTAAGAAGGCCACCAGACATCATCGCTAACCCGGATACA
GGAATGTATGATCCAGACACTGGAGGGACATCTGTGTTTAATCGACCTAGAGTATTGCGTCGTGCTGAAG
GAGACTTTTTTATACCCTCAGGCACAGACATTCCACCTGATTTAAAAGTAAAGAAAGATAGTTACAACGA
GCGCTTGAAGGCGACACACTATACAATCATGCCATTAAAACCAATGTTCAAAGAAAGTCTCATGGGCCAG
CTTGATAACTTCGTACGGAACGCTATTCGACGCCAATACGAAAAAGCTCGTGGATTGTAG

Reference
(1) Silverman JM et al. (2013). Haemolysin Coregulated Protein Is an Exported Receptor and Chaperone of Type VI Secretion Substrates. Mol Cell. 51(5):584-93. [PudMed:23954347] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature