SecReT6
Effector Protein ID: 336247150
-
SecReT6 ID447
T6SS typeA3
Gene symbol-
Locus tagEAE_03230
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]674938..675420 [-]
Productprotein hcp1
Effector typeProtein
Homologous effectorSMA3455
DescriptionHcp protein
UniProt IDG0E1Z0
KEGG IDeae:EAE_03230
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.50E-37, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|336247150|ref|YP_004590860.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MAIDMYLKVDGVTGESNDSNHKNWIDVLSFSWAAEQPGNMSVGGGGGAGKVNFQDLSVQALIDKATPAVL
KFCASGKHVAKVELSICKAGGSQIEYSRVVLEDVLVTKTSFSGVGHTDTIMVNYLFQASKVNLHYWEQSS
QGTKGAETKSGWDIKQNKEI
-
Nucleotide Sequence: 483 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c675420-674938 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGGCTATTGATATGTATCTGAAGGTTGATGGGGTAACCGGTGAATCTAACGACTCAAATCATAAAAATT
GGATAGATGTTTTGTCATTTAGCTGGGCGGCTGAGCAGCCTGGGAATATGAGCGTTGGCGGCGGTGGCGG
AGCGGGTAAAGTTAATTTTCAGGACCTTTCGGTACAAGCATTGATAGATAAAGCAACGCCGGCAGTTCTC
AAGTTTTGCGCTAGCGGTAAACATGTCGCTAAAGTCGAACTATCAATTTGCAAAGCCGGCGGCTCGCAAA
TTGAGTATTCGCGTGTTGTCCTTGAAGATGTTCTGGTGACGAAAACCAGTTTTAGCGGTGTGGGTCATAC
CGACACTATTATGGTGAATTACCTGTTTCAGGCATCTAAAGTTAATCTGCATTATTGGGAGCAGTCTTCT
CAAGGGACCAAAGGCGCAGAAACTAAATCGGGTTGGGATATCAAACAGAATAAAGAAATTTAA