SecReT6
Effector Protein ID: 336250356
-
SecReT6 ID447
T6SS typeA3
Gene symbol-
Locus tagEAE_19400
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4156585..4157067 [-]
Producttype VI secretion system secreted protein Hcp
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDG0E8A3
KEGG IDeae:EAE_19400
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-38, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|336250356|ref|YP_004594066.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MAIDMFLKVEGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAIL
KHCSSGKHLTKVELSVCKAGGQQVEYARITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTS
AGGKGAESSAGWNIKENKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4157067-4156585 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGGCTATTGATATGTTTCTGAAGGTCGAGGGTGTAACCGGTGAATCAAAAGATTCTAATCACACCGGTT
GGACTGATATTACCTCTTTTTCCTGGGGCGCATCCCAGCCGGGTAATATGAGCGTGGGCGGCGGTGGCGG
TGCGGGTAAAGTGAATTTCAACGACCTGCACGTAAATGCGCTGATCGACAAATCCACCACCGCGATTCTG
AAGCACTGCTCCAGCGGCAAGCACCTGACCAAAGTTGAACTTTCGGTCTGCAAAGCCGGTGGTCAGCAGG
TTGAATATGCGCGAATCACCCTCGAAGATGTACTGGTGACTTCTGTGCAGTACACCGGCGCCGATAACGG
CGACACCGTTGGCGTAACCTATGCCTTCCAGGCGGCGAAAGTGAAACAGCAGTACTGGGAGCAGACTTCC
GCTGGCGGTAAAGGGGCAGAAAGCAGCGCCGGCTGGAATATCAAAGAAAATAAAGAAGCATAA