SecReT6
Effector Protein ID: 336250625
-
SecReT6 ID448
T6SS typeA2
Gene symbol-
Locus tagEAE_20755
StrainEnterobacter aerogenes KCTC 2190
Repliconchromosome [GenBank: NC_015663] [Browse all T6SS(s) in this replicon]
Location [Strand]4447373..4447864 [-]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDG0EB08
KEGG IDeae:EAE_20755
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.80E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|336250625|ref|YP_004594335.1| unnamed protein product [Enterobacter aerogenes KCTC 2190]
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPLMHDIKNPAYEKHSHLEQIELRYE
KITWTYKDGNIIHSDSWNERTTA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|336246508|ref|NC_015663.1|:c4447864-4447373 Enterobacter aerogenes KCTC 2190 chromosome, complete genome
ATGGCAATACCAGTCTATTTGTGGTTGAAAGACGACGGCGGGGCGGACATTAAAGGTTCCGTGGATGTGA
AAGATCGGGAAGGCAGCATCGAAGTGGTGGCGCAGGAGCATAACCTGTACATCCCGACCGACAACAACAC
CGGAAAGCTAACCGGCACGCGTATCCACACGCCGTTTCTGTTTACCAAGGAAATCGACTCCTCAAGCCCC
TATCTCTACAAGGCGGTGACTACCGGCCAGACGCTGAAGTCTGCCGAATTCAAGTGGTACAAAATCAATG
ATGCTGGTCAGGAAGTGGAATACTTCAACACAAAACTGGAAAACGTGAAAGTGGTGAAGGTCAATCCGCT
GATGCACGACATCAAGAACCCAGCCTACGAGAAGCACAGCCATCTTGAGCAGATTGAACTGCGCTACGAA
AAAATCACCTGGACCTATAAAGACGGCAACATCATTCATTCCGATTCATGGAATGAACGAACGACAGCCT
GA