SecReT6
Effector Protein ID: 339492246
-
SecReT6 ID452
T6SS typeN/A
Gene symbol-
Locus tagPSTAB_0169
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T6SS(s) in this replicon]
Location [Strand]190002..190520 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDF8H4C2
KEGG IDpsz:PSTAB_0169
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.20E-40, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|339492246|ref|YP_004712539.1| hypothetical protein PSTAB_0169 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MPTPAYLSLEGTKQGLITAGTFTEDSVGNIFQEGHEDQILVQAFQHQVIIPRDPQSGQPTGQRVHKPLMI
TKVFDKSSPLIFNALTSGERLNKCRLEWYRTSSTGTQEHYFTIELEDAVIVDVQSRMPNCQDPNMSHFTH
LEDVYFTYRKIVWTHEVSGTSGSDDWRTPIAG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|339492077|ref|NC_015740.1|:190002-190520 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGCCAACACCCGCGTATCTGTCCCTCGAAGGCACCAAGCAAGGCCTGATCACCGCTGGCACCTTCACCG
AGGACTCGGTTGGCAACATTTTCCAGGAAGGCCATGAGGACCAGATCCTGGTGCAGGCCTTCCAGCATCA
GGTCATCATCCCGCGTGACCCGCAGTCCGGCCAGCCGACTGGCCAGCGCGTGCACAAGCCCCTGATGATC
ACCAAGGTGTTCGACAAGTCGTCGCCGCTGATCTTCAACGCACTGACGTCCGGCGAGCGCCTGAACAAGT
GCCGTCTGGAGTGGTATCGCACCTCGTCCACCGGTACTCAGGAACACTACTTCACCATCGAACTGGAAGA
TGCGGTGATCGTCGACGTGCAGTCGCGCATGCCCAACTGCCAGGACCCGAACATGTCGCACTTCACCCAT
CTGGAAGACGTGTACTTCACCTATCGCAAGATCGTCTGGACCCACGAGGTATCCGGCACCTCCGGCTCCG
ACGACTGGCGCACCCCGATCGCCGGCTGA