SecReT6
Effector Protein ID: 339999227
SecReT6 ID454
T6SS typeA4a
Gene symbol-
Locus tagSBG_1240
StrainSalmonella bongori NCTC 12419
Repliconchromosome [GenBank: NC_015761] [Browse all T6SS(s) in this replicon]
Location [Strand]1359686..1360162 [+]
Producttype VI secretion effector protein Hcp
Effector typeProtein
Homologous effectorHcp
DescriptionHcp
UniProt IDF8VIG6
KEGG IDsbg:SBG_1240
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.40E-41, Aligned region: 5..135
Protein Sequence: 158 a.a.     [Download]
>gi|339999227|ref|YP_004730110.1| type VI secretion effector protein Hcp [Salmonella bongori NCTC 12419]
MDAIFLKLDDIKGECQVDGFKDQIEIMSYSHNVAMQVTNDVSNTERTSGRAHVGEMSLTKFVDLSTPKLN
EYCCGGKMIKEGTLTLCRNDDGKMLPFIVYTLTNVLISHLSVSGGSGGKPVETMSLNFTKIKWEITAQKE
GGQKEGNVSSLWDMAMNK
-
Nucleotide Sequence: 477 bp     [Download]
>gi|339998036|ref|NC_015761.1|:1359686-1360162 Salmonella bongori NCTC 12419, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACGATATCAAAGGTGAATGTCAGGTCGATGGGTTTAAAGATCAGA
TAGAAATTATGTCCTACAGCCATAACGTGGCGATGCAGGTCACCAACGACGTCAGTAATACCGAGCGCAC
TTCCGGACGGGCGCATGTGGGGGAAATGTCGCTGACCAAATTTGTCGATCTTTCCACGCCGAAGCTTAAT
GAGTACTGCTGTGGCGGCAAAATGATCAAAGAAGGGACTCTGACGCTATGCCGTAATGACGATGGCAAAA
TGCTGCCGTTTATCGTTTATACCCTGACCAACGTATTGATCTCGCATCTGAGCGTCAGCGGCGGCTCCGG
CGGTAAGCCAGTCGAAACGATGTCGCTCAATTTCACCAAAATTAAATGGGAAATCACCGCGCAGAAGGAG
GGGGGGCAGAAAGAGGGCAACGTCTCATCCCTCTGGGATATGGCGATGAATAAATAA