SecReT6
Effector Protein ID: 340787989
-
SecReT6 ID455
T6SS typeA4b
Gene symbol-
Locus tagCFU_2805
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]3331054..3333354 [-]
Productputative transmembrane protein
Effector typeProtein
Homologous effectorBTH_II0090
Description
UniProt IDG0A9K8
KEGG IDcfu:CFU_2805
PDB IDNA
Domain hit(s) vs Pfam DUF3274 [PF11678], Evalue: 2.80E-101, Aligned region: 421..713
Abhydrolase_2 [PF02230], Evalue: 0.0059, Aligned region: 37..55
Abhydrolase_2 [PF02230], Evalue: 0.0059, Aligned region: 259..285
Abhydrolase_6 [PF12697], Evalue: 0.0065, Aligned region: 38..61
Abhydrolase_6 [PF12697], Evalue: 0.0065, Aligned region: 246..314
PGAP1 [PF07819], Evalue: 0.0074, Aligned region: 245..304
Protein Sequence: 766 a.a.     [Download]
>gi|340787989|ref|YP_004753454.1| putative transmembrane protein [Collimonas fungivorans Ter331]
MADTNSDYHVVGAAGAVTYADRGNDRPAQLPRDLPGIVIFLHGVNDTGAVYSFVEDGLCKGLNERLSRND
LSPGRYGAQYSQLKAKKNPSTIDDEKLSDPDTYLYQRKEIAGTTKSSFIPFYWGYRAQNDEIARLNSRGK
SNTEEVKGGVADKDGNLMTRGQYQDIHGNRLDKHFGKAGGFFANATNNIPQMYGEGFRADFAARSVTKYA
LGGNSMYAADAPERRYFVLAATRLAHLINMIRSVKPSALAAAQGMQPEHETITIMGHSQGTILTLLAQAI
LKQKGQRCVDCIIMVDTPYSLYQTDDCNQTGHAKLKTLIDIVNEVTKKPYTIPDLADMMINHDKHGGRAG
TDWSKTQGKRLDKSGKNWVTFDERDNRGKVYLYFCPEDTVVGLKKIHGIGTFGVPDEVPADGAAKKANKQ
TMDAMKILESKRFFQRMWTRMTRDNNFDGKYKKVLVGVKPARVPVRDQYERLSPGPDASAGDQGKNAILQ
ASFKRNDIRFINGEELKPPCEPDMYGGEVKGKTGGARPGHADRAGMMAPDDVTKNVILGNQYAGLEWKTV
EHTINPFYDLEKRKAEFNKQYTDVDDQSHKWRMGASLLPGYAVEREETPREARERMMTDEDAHEANNYHS
GLLHAAENHRWVTAMDVAIGQAVTMDDPVWRELLVAIADWKLDPAAFNVITKNKAYTDRLSQEARDFIEA
CKDYYQTGTFPGEQFVSMTMPPLVTSELTPKATAAQQQAADLQREAEMRFYQNQAAQGMANLGNMR
-
Nucleotide Sequence: 2301 bp     [Download]
>gi|340785197|ref|NC_015856.1|:c3333354-3331054 Collimonas fungivorans Ter331 chromosome, complete genome
ATGGCCGATACCAACAGCGACTATCACGTTGTCGGCGCCGCCGGCGCCGTCACCTATGCCGACCGGGGGA
ATGACCGCCCAGCGCAGCTGCCGCGCGATCTGCCGGGCATCGTGATTTTTCTCCATGGCGTCAACGATAC
TGGCGCGGTATATTCGTTCGTCGAAGACGGGCTTTGCAAGGGGCTTAATGAGCGGCTATCGCGGAATGAC
TTGAGCCCGGGACGCTATGGGGCTCAATATAGCCAATTGAAAGCAAAAAAAAATCCTAGTACGATCGACG
ATGAAAAACTGTCCGACCCCGATACCTATCTTTATCAGCGCAAGGAAATTGCTGGCACAACCAAAAGCAG
CTTCATTCCGTTTTACTGGGGGTATCGTGCACAAAACGATGAAATTGCGCGGCTCAACTCCAGGGGGAAA
AGCAACACCGAAGAAGTAAAAGGTGGTGTCGCTGATAAGGACGGCAATTTGATGACGCGCGGCCAGTATC
AGGACATACACGGGAATCGCCTTGATAAGCATTTCGGCAAGGCGGGAGGCTTCTTCGCAAACGCGACGAA
CAACATCCCACAAATGTACGGTGAGGGGTTCAGAGCGGACTTTGCCGCGCGCTCAGTGACCAAGTATGCC
TTGGGTGGGAACTCGATGTATGCCGCTGACGCACCGGAGCGCCGTTATTTTGTCCTGGCGGCGACGCGTC
TGGCGCATCTGATCAACATGATTCGATCGGTCAAGCCCTCCGCGCTTGCCGCGGCGCAAGGCATGCAGCC
TGAACATGAAACGATCACCATCATGGGGCATAGCCAGGGAACGATCCTGACCTTGCTGGCGCAGGCCATC
CTGAAACAGAAGGGGCAGCGCTGCGTCGATTGCATCATAATGGTCGATACTCCCTACAGCCTCTACCAGA
CTGACGACTGCAATCAAACCGGCCACGCCAAACTCAAGACTTTGATCGACATCGTCAATGAAGTGACGAA
AAAGCCCTACACGATTCCCGACCTGGCCGACATGATGATCAACCATGACAAGCACGGTGGCCGCGCCGGG
ACAGACTGGAGCAAGACGCAAGGCAAGCGCCTGGACAAGAGCGGCAAGAACTGGGTGACATTTGACGAAC
GCGATAACCGCGGCAAGGTGTATTTGTACTTCTGCCCCGAGGATACTGTCGTGGGGCTGAAGAAAATCCA
TGGCATCGGCACTTTCGGGGTTCCCGATGAAGTGCCTGCCGACGGCGCGGCAAAAAAAGCAAACAAGCAG
ACCATGGACGCCATGAAGATTCTGGAGAGCAAGCGCTTCTTTCAGCGGATGTGGACGCGGATGACGCGCG
ACAACAATTTCGATGGCAAGTACAAGAAAGTGCTGGTAGGCGTCAAGCCGGCACGGGTGCCGGTTCGTGA
TCAATACGAACGCTTGTCGCCTGGTCCCGACGCCAGTGCGGGGGATCAAGGCAAGAACGCCATACTGCAG
GCGAGCTTTAAACGCAACGATATCCGTTTCATCAACGGAGAAGAGTTGAAACCGCCCTGCGAACCTGACA
TGTATGGCGGTGAGGTCAAAGGTAAAACCGGCGGCGCCAGGCCTGGACATGCTGATAGGGCTGGGATGAT
GGCGCCGGACGACGTCACCAAGAATGTGATCTTGGGCAATCAGTATGCGGGTCTGGAATGGAAAACGGTA
GAACATACGATCAATCCCTTTTATGACCTGGAAAAAAGGAAAGCGGAGTTCAATAAACAGTACACAGATG
TCGACGACCAATCCCATAAATGGCGCATGGGTGCTAGTCTTCTCCCCGGATACGCAGTGGAACGCGAAGA
AACGCCGAGAGAAGCGCGTGAACGGATGATGACCGACGAGGACGCCCACGAAGCCAATAACTATCATTCT
GGCTTGCTGCATGCTGCAGAAAATCACCGCTGGGTAACGGCGATGGATGTCGCGATCGGACAGGCTGTGA
CGATGGACGATCCTGTCTGGCGGGAACTGCTGGTGGCCATTGCAGACTGGAAATTGGATCCAGCGGCTTT
TAACGTGATTACGAAGAACAAAGCCTACACAGATCGGTTGTCTCAGGAAGCAAGGGATTTTATTGAGGCA
TGTAAAGATTATTATCAGACGGGCACATTTCCCGGCGAACAGTTTGTCTCCATGACGATGCCGCCGCTCG
TGACCAGTGAATTGACACCAAAGGCTACGGCGGCACAGCAACAGGCAGCTGACCTGCAGAGAGAAGCGGA
AATGCGCTTTTACCAGAATCAAGCCGCCCAGGGGATGGCAAATTTGGGTAACATGCGATGA