SecReT6
Effector Protein ID: 340787990
-
SecReT6 ID455
T6SS typeA4b
Gene symbol-
Locus tagCFU_2806
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]3333374..3336175 [-]
Productputative Vgr-like protein
Effector typeProtein
Homologous effectorBTH_I3225
Descriptiontype VI secretion system Vgr family protein
UniProt IDG0A9K9
KEGG IDcfu:CFU_2806
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-64, Aligned region: 45..381
Phage_GPD [PF05954], Evalue: 1.20E-64, Aligned region: 672..697
DUF2345 [PF10106], Evalue: 5.50E-40, Aligned region: 706..855
T6SS_Vgr [PF13296], Evalue: 8.80E-36, Aligned region: 567..675
T6SS_Vgr [PF13296], Evalue: 8.80E-36, Aligned region: 744..809
Phage_base_V [PF04717], Evalue: 3.70E-19, Aligned region: 174..192
Phage_base_V [PF04717], Evalue: 3.70E-19, Aligned region: 448..550
Protein Sequence: 933 a.a.     [Download]
>gi|340787990|ref|YP_004753455.1| putative Vgr-like protein [Collimonas fungivorans Ter331]
MNLADALQAFASGSLNQENRPIRLHWGNAQTTLEQVLVVQRIDITEGLCAGIEGHLTCLSTRSNLPLNAF
IGLPVSVQLVNDRGALHQICGIITDARAGQSDGSLATYQLTIRDALSVLERRINTRMFRTKNVVDVIDIL
LKEWQKKSPALARAFDFDLSGTDRSQYPVRELTVQFHESDADFIRRLCRREGIAWFTAAGQREQDSSASN
NANNSDLPIHTLVFFDDPMKLPQSGAGTIRYHRDAATEERDSVTLWSAMQQLVSGSVQRASADYKSGKMA
QASQTSIIDQGQAGNDLAQLLSDSVIDVPHAGDSWADYDRLTKARMLSHELRAASVDGASGVRDLAVGRW
FELTGHPDVDLQPQEQRQFMVTALHHRGENNLPKELNERAQSLFDSSRWHAGSLATITQTLSPGTPDTRY
NNTFTCVRRGVALTPAYDPRIDLPRVYPITALVVGPQGEEVHCDEFGRIKIQIQGLNPDDHAHAQGAGTS
GTQTDSAYVRVSSSWAGKNYGHDTVPRVGMEVALDFLNGDPDKMFVTGVLHNGPNMPATFSHTGALPGNR
FLSGVKTKEIKGNRYNQLRFDDTAGQISSQLASEHAASELNLGFLTQPRTDGSGEARGEGAELRTDAAAS
LRAAKGILLTTYARNKATGHFLERDELNQLLSECTELFKALGDYAGQHGGQAADGAAQNQLAAELKNWDA
TSSGAGSTSAGAGDAAAIMAFGAATGSIAVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLF
ARGKGIQAIAGEGPMLLQVQTDALTANAQKGVKISSNENEVLITAPTIRFVAEDGSYIKIGGGVTLGTNG
DIKLLSASHQWGGPSTQQAAKANFNNAPTDQRFRLHYPGESPESAAAAAHQPYRITMDDGRVIEGKSDAN
GHTDLVKDDAMRILKIDILKPAL
-
Nucleotide Sequence: 2802 bp     [Download]
>gi|340785197|ref|NC_015856.1|:c3336175-3333374 Collimonas fungivorans Ter331 chromosome, complete genome
GTGAATCTCGCCGACGCATTGCAAGCGTTTGCCTCCGGTTCGTTGAATCAGGAAAACCGACCTATTCGTC
TGCACTGGGGCAATGCCCAGACGACCCTCGAACAGGTCCTGGTCGTTCAGCGCATCGACATTACCGAGGG
CCTTTGTGCAGGTATCGAAGGGCATTTGACCTGTCTGTCGACGCGCTCCAACCTGCCGCTCAACGCGTTT
ATCGGGCTGCCGGTATCGGTTCAGCTGGTTAACGACCGAGGCGCACTGCATCAGATTTGCGGGATCATCA
CGGACGCGCGTGCGGGGCAATCGGATGGATCGCTCGCTACCTATCAATTAACTATCCGCGACGCATTGTC
GGTGCTGGAGCGACGGATCAATACCCGCATGTTCCGCACTAAAAATGTGGTGGACGTGATTGATATCTTG
CTGAAGGAATGGCAGAAGAAAAGCCCTGCGCTCGCGCGGGCCTTCGACTTTGATCTGTCCGGCACCGATC
GCAGTCAGTATCCTGTGCGCGAACTCACGGTGCAGTTTCATGAATCCGATGCCGATTTTATCCGCCGGCT
CTGCCGTCGCGAAGGTATTGCCTGGTTCACGGCAGCCGGCCAACGGGAACAGGATTCGTCTGCCAGCAAT
AACGCCAATAACAGCGATTTACCGATACATACGCTGGTGTTTTTCGATGACCCGATGAAATTGCCGCAAT
CGGGCGCCGGCACGATCCGCTATCACCGTGATGCCGCTACTGAAGAGCGCGATTCGGTGACGCTGTGGTC
GGCCATGCAACAACTGGTGTCCGGCAGCGTCCAGCGAGCCAGTGCAGATTACAAGAGTGGCAAGATGGCG
CAGGCGTCGCAAACCAGTATCATCGACCAGGGACAGGCCGGCAACGATCTCGCGCAACTTCTCTCCGATA
GCGTCATTGATGTGCCGCACGCCGGGGATTCCTGGGCGGATTACGACCGGCTGACCAAGGCGCGGATGCT
GTCGCACGAATTACGGGCCGCCAGCGTCGACGGCGCGAGCGGCGTGCGCGATCTGGCGGTCGGCCGCTGG
TTCGAACTGACTGGCCATCCCGATGTGGATCTGCAACCGCAGGAGCAGCGGCAGTTCATGGTCACCGCCT
TGCATCACCGCGGCGAGAATAACTTGCCGAAGGAGCTCAACGAGCGCGCGCAATCATTGTTTGACAGCAG
CCGCTGGCACGCAGGTTCGTTGGCGACCATCACCCAGACACTCTCGCCAGGAACACCCGACACCCGTTAC
AACAACACCTTCACCTGCGTGCGGCGTGGCGTAGCATTGACTCCGGCATACGATCCGCGCATCGATCTGC
CACGTGTCTATCCGATCACGGCGCTGGTAGTCGGACCGCAAGGGGAAGAAGTTCACTGTGACGAATTCGG
TCGCATCAAGATACAGATACAGGGCTTGAATCCGGACGATCATGCGCATGCCCAAGGCGCGGGAACGAGC
GGAACACAGACAGACAGCGCCTATGTGCGGGTCAGCAGCAGCTGGGCCGGTAAAAACTATGGCCACGATA
CCGTGCCGCGGGTAGGGATGGAGGTTGCCCTGGATTTCCTGAATGGCGATCCGGATAAAATGTTCGTCAC
CGGCGTATTGCACAACGGGCCGAACATGCCTGCGACATTCAGTCATACCGGCGCGCTGCCGGGCAATCGT
TTTCTGTCCGGCGTGAAGACGAAAGAGATCAAAGGAAACCGCTACAACCAGTTGCGTTTTGATGACACTG
CGGGCCAGATCAGCAGCCAGCTGGCCAGCGAGCATGCGGCCAGTGAGCTCAACCTCGGTTTTCTGACGCA
ACCGCGCACGGACGGCAGTGGCGAGGCCCGCGGTGAAGGCGCGGAATTGCGCACTGATGCTGCGGCTTCG
CTGCGCGCAGCGAAAGGCATCCTCCTGACAACCTACGCGCGCAACAAGGCGACGGGGCACTTTCTTGAGC
GCGACGAACTGAACCAGTTGCTCTCCGAGTGCACGGAATTGTTCAAGGCTCTGGGCGACTATGCCGGCCA
GCATGGCGGCCAGGCTGCGGATGGCGCTGCCCAGAATCAGCTCGCAGCAGAACTCAAGAATTGGGATGCA
ACCAGCAGTGGCGCGGGTAGTACATCTGCTGGCGCCGGGGACGCAGCAGCCATCATGGCATTCGGCGCGG
CCACGGGGTCCATCGCGGTCACGCCCAAAACGCATGTGACCTATGCCGGCGAGAACATCGACCAGGTAGC
GCAGCAGCATCTGCAATTGATGAGTGGCCAGCGCCTGAATGCCACTGCGGGCCAGGGCATGCAGTTGTTC
GCACGCGGCAAAGGCATTCAGGCGATTGCCGGCGAAGGGCCGATGCTCCTGCAAGTGCAGACGGATGCAT
TGACGGCCAACGCACAAAAGGGCGTCAAGATCAGCAGCAACGAAAATGAAGTGCTGATCACGGCGCCGAC
GATCCGCTTCGTTGCCGAAGACGGCAGTTACATCAAGATCGGCGGCGGCGTGACGCTGGGTACCAACGGA
GATATTAAGCTGCTCTCCGCGTCGCACCAGTGGGGCGGCCCCTCGACGCAGCAGGCGGCCAAGGCAAATT
TCAACAACGCACCGACGGATCAGCGTTTCCGCTTGCACTATCCCGGCGAGTCGCCAGAATCGGCGGCTGC
GGCGGCTCACCAGCCTTACCGTATCACGATGGACGACGGACGGGTGATCGAGGGCAAGAGCGATGCGAAC
GGCCATACCGACCTGGTCAAGGACGACGCCATGCGCATCCTCAAGATTGACATCCTGAAACCTGCACTAT
GA