SecReT6
Effector Protein ID: 345299090
-
SecReT6 ID457
T6SS typeA2
Gene symbol-
Locus tagEntas_1924
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]2070261..2070752 [+]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDG2SBY4
KEGG IDeas:Entas_1924
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.40E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|345299090|ref|YP_004828448.1| Hcp1 family type VI secretion system effector [Enterobacter asburiae LF7a]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQQHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPEMYDIKDPSKEKHNHLERIELRYE
KITWTYKDGNIIHSDSWNERATA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|345297184|ref|NC_015968.1|:2070261-2070752 Enterobacter asburiae LF7a chromosome, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGACGGCGGCGCGGACATTAAAGGTTCTGTGGACGTTC
AGGATCGTGAAGGCAGCATCGAAGTGGTGGCACAGCAGCATAACCTGTACATCCCGACTGACAACAACAC
CGGCAAACTGACCGGTACCCGTATCCACACCCCGTTCCTGTTCACCAAGGAAATCGACTCGTCCAGTCCG
TACCTGTACAAGGCGGTGACCACCGGTCAGACCCTCAAGTCTGCGGAATTCAAGTGGTACAAAATCAACG
ACGCGGGCCAGGAAGTGGAGTACTTCAACACCAAACTGGAAAACGTGAAAGTGGTGAAAGTGAATCCTGA
AATGTATGACATCAAGGATCCTTCTAAAGAGAAGCACAACCACCTTGAGCGCATTGAACTGCGTTACGAA
AAAATCACCTGGACCTACAAAGACGGCAACATCATTCATTCCGATTCCTGGAACGAACGCGCCACCGCCT
AA