SecReT6
Effector Protein ID: 345299225
-
SecReT6 ID457
T6SS typeA2
Gene symbol-
Locus tagEntas_2063
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]2231243..2231725 [-]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDG2S208
KEGG IDeas:Entas_2063
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.00E-28, Aligned region: 33..146
Protein Sequence: 160 a.a.     [Download]
>gi|345299225|ref|YP_004828583.1| Hcp1 family type VI secretion system effector [Enterobacter asburiae LF7a]
MLLFILYTANNSHIKIMDYLTQMEIVVMAIPAYLWLKDDGGADINGSVDVQDREGSIEIHSFAHGLHLPT
DNMTGKITGNRVHSAMTFEKEFDSSSPYLYKAVAKGQTLDSAEFKWYHINDAGQEVEYFNMLLEGVKVVS
ICPLMHNCKNAGFLPRIFRF
-
Nucleotide Sequence: 483 bp     [Download]
>gi|345297184|ref|NC_015968.1|:c2231725-2231243 Enterobacter asburiae LF7a chromosome, complete genome
ATGCTGTTGTTTATTCTGTATACAGCCAACAATAGCCATATTAAAATCATGGATTACTTAACTCAAATGG
AGATTGTGGTTATGGCTATTCCGGCTTATTTATGGCTTAAAGACGATGGAGGCGCAGATATCAATGGTTC
TGTCGACGTTCAGGATCGAGAAGGTAGTATTGAGATTCATAGTTTTGCCCACGGCCTGCATCTGCCCACG
GACAACATGACGGGTAAAATTACAGGTAACCGAGTTCATAGCGCAATGACGTTCGAAAAGGAGTTCGATT
CATCAAGTCCCTACCTTTATAAGGCTGTCGCAAAAGGCCAAACGCTAGATAGTGCCGAATTTAAGTGGTA
CCACATTAACGATGCAGGACAGGAGGTTGAATACTTCAACATGCTGCTGGAAGGCGTCAAAGTCGTATCG
ATCTGCCCGTTGATGCATAACTGCAAAAATGCTGGGTTTCTTCCCCGCATATTCAGGTTTTGA