SecReT6
Effector Protein ID: 360035309
hcp
SecReT6 ID513
T6SS typeA1
Gene symbolhcp
Locus tagVch1786_I0914
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016445] [Browse all T6SS(s) in this replicon]
Location [Strand]986816..987145 [+]
Producthcp protein
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDG7TR71
KEGG IDvce:Vch1786_I0914
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.40E-25, Aligned region: 2..92
Protein Sequence: 109 a.a.     [Download]
>gi|360035309|ref|YP_004937072.1| hcp protein, partial [Vibrio cholerae O1 str. 2010EL-1786]
MHKPFKFTVALNKAVPLLYNALSSGEKLKTVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDP
AKSDFTQNVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
-
Nucleotide Sequence: 330 bp     [Download]
>gi|360034408|ref|NC_016445.1|:986816-987145 Vibrio cholerae O1 str. 2010EL-1786 chromosome 1, complete sequence
GTGCACAAGCCATTCAAATTCACTGTGGCGCTGAACAAAGCGGTTCCTCTGCTGTACAACGCGCTCTCTT
CAGGTGAGAAGCTGAAAACCGTTGAGCTGAAATGGTACCGTACTTCTATCGAAGGCAAACAAGAAAACTT
CTTCACCACTAAGCTGGAAAACGCGTCTATCGTTGATATCCACTGTGAAATGCCACACTGCCAAGACCCA
GCAAAATCTGACTTTACTCAGAATGTGACTGTGTCTCTGTCTTACCGCAAAATCACTTGGGACCACGTTA
ACGCGGGCACCTCAGGCTCTGATGACTGGCGTAAGCCAATCGAAGCGTAA