SecReT6
Effector Protein ID: 360035312
-
SecReT6 ID513
T6SS typeA1
Gene symbol-
Locus tagVch1786_I0917
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016445] [Browse all T6SS(s) in this replicon]
Location [Strand]991606..993531 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVC1418
DescriptionTseL
UniProt IDG7TR74
KEGG IDvce:Vch1786_I0917
PDB IDNA
Domain hit(s) vs Pfam Lipase_3 [PF01764], Evalue: 1.20E-22, Aligned region: 319..434
CarboxypepD_reg [PF13620], Evalue: 0.0047, Aligned region: 23..88
Protein Sequence: 641 a.a.     [Download]
>gi|360035312|ref|YP_004937075.1| hypothetical protein Vch1786_I0917 [Vibrio cholerae O1 str. 2010EL-1786]
MDSFNYCVQCNPEENWLELEFRSENDEPIDGLLVTITNQSAPSNTYTQTTSSGKVLFGKIAAGEWRASVS
QASLLTEVEKYASRKEGQESPVKKRAAAELDAADKDTKQYRFTTIGDFWDEAPKDEFLQKQHKGIDVNAS
AEKAGFRLSHNQTYVFEIKALRSYMPVIIDTDEFNLVNSYTFALLSKLAYATNDFNRDDGKTIDNQGAIS
TVISQLKRKERPTYSGDLQAKWLLEEIPYSKALSAQYYAEDDVGSEGYIIFNDELAIIGVRGTEPYFQSK
KPPVDNTKFKIIKAASGMAAVIADKIESATDSPGMKDLIITDLDAAQIAPEEFGGTYVHRGFYQYTMALL
SLMEKDLGLHKIKKFYCCGHSLGGAGALLISALIKDSYHPPVLRLYTYGMPRVGTRSFVERYQNILHYRH
VNNHDLVPQIPTVWMNTDVSEGFHVLDVFKSRVDLMRKMLTDDDDDNYQHHGHLSQLLTYNSNNQVLLTP
KQTQVTMLDLANLATNDSVAMVDGLSDASIVEHGMEQYIPNLFEQLTALSDESLMVHYQRAISALEQEIA
TLQQSYLTVKQAWIESIGNGTPTMNIGRLMSEMHSINKLIENRNKIRGELRQIVSDPQRMPATKFLISQQ
TLPDEIKVQIR
-
Nucleotide Sequence: 1926 bp     [Download]
>gi|360034408|ref|NC_016445.1|:991606-993531 Vibrio cholerae O1 str. 2010EL-1786 chromosome 1, complete sequence
ATGGATTCATTTAATTATTGCGTGCAGTGTAACCCTGAGGAAAACTGGTTAGAGCTAGAGTTTCGGAGTG
AAAATGATGAACCGATAGATGGTTTGCTAGTTACGATTACGAACCAAAGTGCCCCCTCTAACACATACAC
GCAAACCACAAGTTCGGGTAAGGTGTTGTTTGGCAAGATTGCGGCTGGGGAATGGCGTGCTTCTGTAAGC
CAAGCTTCTCTGTTAACTGAAGTCGAAAAATATGCCAGCCGTAAAGAGGGACAAGAGTCGCCAGTGAAAA
AACGAGCTGCGGCAGAACTTGACGCCGCAGATAAAGATACGAAGCAGTACCGCTTTACCACTATTGGTGA
TTTCTGGGATGAAGCACCAAAAGATGAGTTTTTACAAAAGCAGCATAAAGGGATAGATGTCAATGCTTCT
GCTGAGAAAGCAGGGTTTAGACTCAGTCATAACCAGACCTATGTTTTTGAAATCAAAGCACTACGTAGCT
ATATGCCAGTGATTATTGATACCGATGAATTTAACTTGGTGAATAGTTATACCTTTGCGTTGTTGTCGAA
ATTAGCTTATGCGACTAACGATTTTAATAGGGATGATGGTAAGACAATAGATAATCAGGGAGCAATTAGC
ACGGTTATTTCTCAATTGAAGCGTAAAGAAAGACCGACTTATTCTGGAGATTTACAAGCAAAGTGGTTAT
TAGAGGAAATTCCATATAGCAAAGCGTTAAGTGCCCAATATTATGCTGAGGATGATGTCGGTAGTGAAGG
TTACATCATCTTTAACGATGAATTGGCGATTATAGGTGTGAGAGGTACAGAGCCTTATTTTCAGAGTAAG
AAACCACCTGTTGATAACACTAAATTTAAAATTATAAAAGCGGCTTCAGGTATGGCGGCTGTGATTGCGG
ATAAGATAGAAAGTGCTACCGATTCACCAGGAATGAAAGACCTTATTATAACAGACCTTGATGCTGCGCA
AATCGCCCCCGAAGAGTTTGGTGGAACATATGTTCATCGGGGGTTTTACCAATATACGATGGCTTTGTTA
TCTTTGATGGAGAAAGATCTAGGGCTACATAAAATAAAAAAATTCTATTGTTGTGGCCATAGCTTAGGGG
GCGCTGGTGCATTACTTATAAGTGCATTGATTAAAGATAGCTATCATCCTCCAGTATTGCGTTTATATAC
ATATGGAATGCCACGAGTGGGAACTCGCAGTTTTGTAGAGCGCTATCAAAATATTTTGCATTACCGTCAT
GTTAATAATCACGATTTGGTGCCACAGATACCAACAGTATGGATGAACACAGATGTATCTGAAGGATTCC
ATGTACTTGATGTATTTAAAAGCCGTGTTGATCTGATGAGAAAAATGCTCACTGATGATGATGATGACAA
TTATCAACACCATGGTCATTTGTCTCAGTTACTAACTTATAATTCAAATAACCAAGTCTTACTGACACCC
AAACAAACTCAAGTCACTATGCTAGACCTAGCAAATTTAGCCACTAATGATTCTGTTGCTATGGTAGATG
GTTTATCAGATGCCTCAATAGTAGAGCATGGAATGGAGCAGTATATACCCAATTTATTTGAGCAGTTAAC
AGCACTAAGTGATGAAAGTTTAATGGTGCATTATCAACGAGCGATTTCAGCCTTAGAGCAGGAAATTGCT
ACGTTGCAACAAAGTTATCTTACAGTTAAACAAGCTTGGATTGAATCTATAGGAAATGGCACGCCGACTA
TGAATATCGGACGTTTGATGAGTGAAATGCATTCTATAAATAAATTAATAGAGAACCGTAATAAAATTAG
AGGTGAGCTAAGGCAGATAGTCTCTGATCCTCAGCGTATGCCTGCAACTAAATTTTTAATTTCACAGCAA
ACCTTACCAGATGAAATCAAGGTGCAAATAAGATGA