SecReT6
Effector Protein ID: 360037245
-
SecReT6 ID513
T6SS typeA1
Gene symbol-
Locus tagVch1786_II0031
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016446] [Browse all T6SS(s) in this replicon]
Location [Strand]31645..32316 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0285
DescriptionTseH
UniProt IDG7TWC3
KEGG IDvce:Vch1786_II0031
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 223 a.a.     [Download]
>gi|360037245|ref|YP_004939007.1| hypothetical protein Vch1786_II0031 [Vibrio cholerae O1 str. 2010EL-1786]
MTDTVSSTPVADTTPYEIFLSGNDDFLIPVVFPDYLISVADEQSFELWGVKIKTPAVKAPYLGHAGVILI
NGETGVTRYYEYGRYKNPKSDIPGNVRKVGVSNVTIKSGLITESSLLKVLKEVSLRSGQEGRISGVVLRG
KFFSEADSWLRGKMDLNNSPDKIPYDLDSHNCMTFVIDLADAMGLDPAWKPPVVVPSAYIEQFQLSEIDL
DYDYKTNKLTVSE
-
Nucleotide Sequence: 672 bp     [Download]
>gi|360037214|ref|NC_016446.1|:31645-32316 Vibrio cholerae O1 str. 2010EL-1786 chromosome 2, complete sequence
ATGACTGACACTGTATCATCAACTCCAGTAGCCGATACAACTCCATATGAGATATTTCTTTCAGGTAATG
ACGATTTTTTGATACCTGTAGTATTTCCTGACTACCTAATCTCAGTCGCAGATGAACAATCTTTTGAGTT
ATGGGGTGTAAAAATAAAAACTCCTGCAGTGAAGGCCCCCTACCTTGGTCACGCTGGAGTTATTTTGATT
AATGGTGAAACAGGTGTTACTCGCTATTATGAGTATGGCCGTTACAAGAACCCTAAATCGGATATCCCAG
GAAATGTGAGGAAGGTTGGGGTATCAAATGTAACTATAAAAAGTGGTCTAATTACTGAAAGCTCGTTACT
GAAGGTTCTTAAAGAAGTGTCCCTACGTTCTGGACAGGAGGGGAGAATTTCGGGAGTGGTATTAAGAGGA
AAGTTTTTCTCTGAAGCAGATTCATGGTTAAGGGGAAAAATGGATCTTAATAATAGCCCTGATAAGATAC
CTTATGACTTGGATAGCCATAACTGCATGACATTTGTCATAGATTTAGCTGATGCAATGGGGTTAGACCC
GGCTTGGAAACCTCCTGTTGTTGTACCAAGCGCGTATATTGAACAGTTTCAGTTAAGTGAAATTGATTTA
GATTATGACTATAAGACCAACAAATTAACGGTATCTGAGTGA