SecReT6
Effector Protein ID: 360038023
hcp-1
SecReT6 ID513
T6SS typeA1
Gene symbolhcp-1
Locus tagVch1786_II0813
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016446] [Browse all T6SS(s) in this replicon]
Location [Strand]792614..793132 [+]
Producthcp protein
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDG7TVL1
KEGG IDvce:Vch1786_II0813
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.30E-38, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|360038023|ref|YP_004939785.1| hcp protein [Vibrio cholerae O1 str. 2010EL-1786]
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALSSGEKLKTVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDPAKSDFTQ
NVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|360037214|ref|NC_016446.1|:792614-793132 Vibrio cholerae O1 str. 2010EL-1786 chromosome 2, complete sequence
ATGCCAACTCCATGTTATATCTCTATCGAAGGCCAAACTCAGGGTCTTATCACTGCAGGCGCATGTACTG
CTGACTCTATCGGCGATTCATTCGTTGAAGGCCATGAAGATGAGATGCTGGTTCAGCAGTTTGACCACGT
CGTAACCGTACCGACTGACCCACAATCTGGTCAGCCTTCCGGCCAACGTGTGCACAAGCCATTCAAATTC
ACTGTGGCGCTGAACAAAGCGGTTCCTCTGCTGTACAACGCGCTCTCTTCAGGTGAGAAGCTGAAAACCG
TTGAGCTGAAATGGTACCGTACTTCTATCGAAGGCAAACAAGAAAACTTCTTCACCACTAAGCTGGAAAA
CGCGTCTATCGTTGATATCCACTGTGAAATGCCACACTGCCAAGACCCAGCAAAATCTGACTTTACTCAG
AATGTGACTGTGTCTCTGTCTTACCGCAAAATCACTTGGGACCACGTTAACGCGGGCACCTCAGGCTCTG
ATGACTGGCGTAAGCCAATCGAAGCGTAA