SecReT6
Effector Protein ID: 360038024
-
SecReT6 ID513
T6SS typeA1
Gene symbol-
Locus tagVch1786_II0814
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016446] [Browse all T6SS(s) in this replicon]
Location [Strand]793260..795344 [+]
Producttype VI secretion system secreted protein VgrG
Effector typeProtein
Homologous effectorVCA0018
Descriptiontype VI secretion system Vgr family protein
UniProt IDG7TVL2
KEGG IDvce:Vch1786_II0814
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-64, Aligned region: 42..335
Phage_base_V [PF04717], Evalue: 3.30E-24, Aligned region: 208..227
Phage_base_V [PF04717], Evalue: 3.30E-24, Aligned region: 374..467
Phage_Mu_Gp45 [PF06890], Evalue: 0.00087, Aligned region: 426..452
Phage_Mu_Gp45 [PF06890], Evalue: 0.00087, Aligned region: 569..618
DUF2345 [PF10106], Evalue: 0.0018, Aligned region: 575..617
Protein Sequence: 694 a.a.     [Download]
>gi|360038024|ref|YP_004939786.1| type VI secretion system secreted protein VgrG [Vibrio cholerae O1 str. 2010EL-1786]
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYQMQLASRVSNLTADQMVDKRAELKLY
RNSQLVQRVHGIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGIHDYA
FALKRDCVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALAGG
TMDTPYIHGLTYRTQAEVSEVQLKDYSFKKPAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFS
QIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEEGGSGATTYN
NQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQ
GWAGSQYGFIAIPRIGHEVIVSFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTETHQGEGFNEL
SFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDQHLTVENDQFTQIKHNQHLTVEGESRTLVKLDCSSE
IGGSLQQKIGSKAIYDAGTEVHLKAGNKLVLEAGNELTIKAGGSFIKVDAGGVHVVGSAINLNSGGSAGS
GSGYGGKMAELPQGVDKAKTPQEIELAAVTPTQQSMSPLLKARQIEALKGPAPVCEVCEEAKGN
-
Nucleotide Sequence: 2085 bp     [Download]
>gi|360037214|ref|NC_016446.1|:793260-795344 Vibrio cholerae O1 str. 2010EL-1786 chromosome 2, complete sequence
ATGGCGACATTAGCGTACAGCATTGAGGTGGAAGGGCTGGAAGATGAGACTCTGGTGGTCAGAGGCTTTC
ACGGGCAGGAGTCACTCTCCAACAGTGTTTTTTTAGGGCAAGCCTGTTACGGGTTTCGCTATCAAATGCA
ACTGGCGAGTCGGGTATCCAATCTGACTGCCGACCAGATGGTCGATAAGCGTGCTGAGCTCAAGCTTTAC
CGCAACTCACAATTGGTGCAGCGTGTGCACGGCATTGTACGTGCCTTTAGCCAAGGCGATATCGGCCATC
ACCACACCTTCTACCAACTCACTTTAGTGCCTGCCTTAGAGCGCTTATCCCTGCGCCACAATAGCCGCAT
TTTCCAAAAGCAGACTGTTCCAGAAATTCTCTCTATCTTGCTGCAAGAGATGGGCATCCACGATTACGCT
TTTGCGCTCAAACGTGATTGCGTGCAGCGTGAGTTTTGTGTGCAGTACCGTGAAAGTGATATCGACTTTC
TGCACCGCCTCGCCGCTGAAGAAGGCTTGGTGTACAGCTTTGTCCATGAAGCGGGCAAACATACCCTCTA
TTTCAGTGATGCCAGTGACAGCCTAAGTAAACTGCCGGAGCCCATCCCGTACAACGCCTTAGCGGGCGGC
ACGATGGATACACCGTACATCCACGGCTTAACCTATCGCACCCAAGCGGAAGTGAGCGAAGTTCAGCTCA
AAGATTACAGCTTCAAAAAGCCGGCGTACTCGTTTTTACAAACCGTGCAGGGTACTGAGCTGGATTATCA
GCAAACGCGCTACCAACATTTTGATGCGCCGGGGCGCTACAAAGACGATGTGAACGGCGCCGCCTTTAGC
CAAATCCGTTTAGACTACCTGCGCCGCCATGCCCACACCGCAACAGGGCAGAGCAACGAGCCGCTGCTGC
GTGCCGGCTATAAGTTTGACCTGCAAGAGCATCTTGACCCTGCGATGAACCGCGATTGGGTGGTGGTCTC
TATTAACCATCAAGGTGAGCAGCCGCAAGCGTTACAAGAAGAGGGCGGCAGTGGTGCAACGACCTACAAC
AACCAGTTCAGCTTAATTCCAGGGCATCTCCACTGGCGCGCCGAGCCACAACCCAAACCGCAAGTCGATG
GTCCAATGATAGCCACGGTCGTCGGTCCTGAAGGCGAAGAAATCTTCTGTGATGAACACGGGCGGGTGAA
AATCCATTTTCCGTGGGACCGCTACTCGAACGGTAACGAGCAAAGCTCCTGTTGGGTACGGGTGTCGCAA
GGTTGGGCGGGCAGTCAGTATGGCTTTATCGCTATTCCGCGCATCGGTCATGAAGTGATTGTTTCTTTCT
TAAATGGCGACCCAGACCAACCGATTATCACTGGCCGCACCTATCATGCGACCAATACGCCGCCATACAC
TTTGCCAGAGCACAAAACCAAAACCGTGCTGCGCACCGAGACGCACCAAGGGGAAGGGTTTAACGAGCTC
AGTTTTGAAGACCAAGCGGGCAAAGAGCAAATCTACCTGCATGCGCAGAAAGACTTCGATGGTTTGATTG
AAAACGACCACACCACGGTCATTCGCCACGACCAACACCTGACCGTTGAAAACGACCAGTTCACTCAGAT
TAAGCACAACCAACACCTGACGGTCGAGGGGGAGAGTCGTACGCTCGTCAAACTCGACTGCAGCAGCGAA
ATCGGCGGTTCATTGCAGCAAAAAATCGGCAGCAAAGCGATTTACGATGCAGGCACAGAGGTTCACCTTA
AAGCGGGTAACAAACTGGTCTTGGAAGCAGGCAACGAGCTTACCATCAAAGCCGGCGGCAGTTTTATTAA
AGTCGATGCTGGCGGTGTGCACGTCGTCGGCTCTGCTATTAACCTCAACTCCGGCGGCAGCGCAGGCAGC
GGCTCAGGCTATGGCGGTAAAATGGCCGAGTTGCCACAAGGGGTGGATAAAGCCAAAACGCCGCAAGAGA
TTGAGCTAGCCGCGGTAACTCCCACTCAGCAGTCTATGTCGCCTTTACTTAAGGCGCGACAAATTGAAGC
ACTCAAAGGTCCTGCACCTGTGTGTGAAGTGTGTGAAGAGGCCAAGGGAAATTAA