SecReT6
Effector Protein ID: 360038026
-
SecReT6 ID513
T6SS typeA1
Gene symbol-
Locus tagVch1786_II0816
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016446] [Browse all T6SS(s) in this replicon]
Location [Strand]796228..799485 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0020
DescriptionVasX protein
UniProt IDG7TVL4
KEGG IDvce:Vch1786_II0816
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1085 a.a.     [Download]
>gi|360038026|ref|YP_004939788.1| hypothetical protein Vch1786_II0816 [Vibrio cholerae O1 str. 2010EL-1786]
MSNPNQAAKTGQTNDAQNPASACPFKQPLIGIIPVRYAFDVYDDQGQALHPLPKADRQWKGQFSIKQRSY
TLRQLRDGWLYVYDETAKTLHEYEVVGCKLTKIDWSDDEANKPTHERGSKGESKSCLLYPAQHTLSIGYA
HQRWTWRVCEHMRSNTSSRHAVMRKVSLKQFESNGTHPHAHFAQYLEDYVADIGTPAEQDIFKDTCTPSL
PVEKSEEAVKGTEFKFVADKAVVSSSDYLQDLPEQNCGLFVALNDPLADVSDLFVTFTTQVAKRTKAIGD
ETQQHKMQMAELTRTLGRIRLEEKEIPDFVKQDPIRILELERAITEYCATAKLAEIESHHLASEGHSPSG
NYALMQQQAEQKLAELKTLYRFEPTSAQMRKWRKKDNSFIDEVRWADLDNFLVEHYTELKGLDEQIKQHY
AQFMSAFNQLGLDPLLFGMDNQDEVQQAYLLALTSQFLVVVTQVNHDEKSLEILKKDLSFDSPKNLMALA
STGFSLQANQAINNHIQGFSTAFLSTSNPSDMVAFATAIANWDTFTGDERIQEKAWFKRWIEPAQSSFGA
LQKAVANQAKESWQAVMELLFPYQNQPKGGTPSLLANLRLLLVESLVREEAVLQHNPKYAAELKQFETKL
NAILQEMNDALELKPGNVSPKNHQIATAQSAQRKLGQLLSSELPMMLTLKNQAAMNTFQQSVNEKLSALS
KNVKTSSASVSQKLGGLGGLLFALNLWNTMTVLENIRYKVAQYPSWNPFKNPALGEAIYATGNTIVVAGA
ISAGRAWVTIAEQGLLDRTLKNALNTTKVLGTKDALKTFAKSIALVATVGMIASALETWESWGKFNDSSK
TDLERFGYLLKAGATGAQGIIFYIQFFTLLGSGIGGPSIAAISAGWMLAGFAVIGIVYLIGVILTNVFKR
SELEIWLSKSTWGKESAHWPVGKELTELEHLLHRPSLRLSQVTQRKAAQWMDSGSLQWQLELTLPDYLKG
QTIGLQITRLPAQPAYYQPQREAVTPILINEQQGKWSIEDNQPVYRITLGGSEKDTVGVCVALPLRWGKE
LSLKFYASGTRAGELDLQSAEANDIATRNLVVGKG
-
Nucleotide Sequence: 3258 bp     [Download]
>gi|360037214|ref|NC_016446.1|:796228-799485 Vibrio cholerae O1 str. 2010EL-1786 chromosome 2, complete sequence
ATGAGTAATCCCAATCAAGCTGCGAAAACAGGACAGACCAATGATGCGCAAAATCCCGCCAGTGCATGTC
CTTTTAAACAGCCGTTAATAGGGATAATTCCTGTTCGTTACGCCTTTGATGTTTATGATGATCAAGGTCA
AGCATTACATCCTTTACCCAAAGCGGATCGACAGTGGAAAGGTCAATTCTCTATCAAGCAGCGCAGTTAC
ACTTTAAGGCAACTGCGTGATGGCTGGCTCTATGTCTATGATGAAACAGCAAAAACACTGCACGAATATG
AAGTCGTTGGCTGCAAGTTGACCAAAATTGATTGGTCTGATGATGAGGCAAACAAACCCACTCACGAGCG
CGGTTCGAAAGGTGAAAGCAAAAGCTGTTTACTCTATCCCGCCCAGCACACGCTCTCTATCGGTTATGCG
CATCAACGATGGACGTGGCGAGTGTGTGAGCATATGCGCTCCAATACCAGCAGCCGTCATGCTGTGATGC
GTAAAGTGAGCCTTAAACAGTTTGAGTCCAATGGTACTCACCCTCATGCACATTTTGCTCAGTATCTTGA
AGACTATGTGGCGGACATCGGGACGCCAGCTGAGCAGGATATTTTTAAAGATACCTGTACCCCTTCATTA
CCGGTAGAGAAAAGTGAAGAAGCGGTGAAAGGTACGGAATTCAAATTCGTTGCCGACAAAGCGGTGGTAA
GCAGCAGTGATTATTTGCAAGATTTGCCGGAGCAAAACTGCGGTTTATTTGTGGCGCTGAATGACCCTTT
AGCGGATGTGTCAGATTTATTTGTTACTTTTACTACCCAAGTGGCAAAGCGAACTAAAGCGATTGGTGAT
GAAACGCAACAGCATAAAATGCAGATGGCAGAGCTGACACGCACATTAGGCCGAATTCGTCTTGAAGAAA
AAGAAATTCCCGATTTTGTAAAACAAGATCCGATCCGTATTTTAGAGCTAGAAAGAGCCATTACTGAATA
TTGTGCTACGGCAAAATTGGCCGAAATCGAATCTCATCATTTAGCCAGTGAAGGGCATTCCCCATCGGGA
AACTATGCCTTGATGCAGCAGCAAGCGGAGCAGAAACTGGCGGAATTGAAAACACTCTATCGCTTTGAAC
CCACCAGTGCTCAGATGCGCAAGTGGCGCAAAAAAGACAACAGCTTTATTGATGAAGTGCGTTGGGCGGA
TTTAGATAACTTTTTGGTGGAGCATTACACCGAGCTCAAAGGATTGGATGAACAGATTAAACAACACTAT
GCGCAGTTTATGTCTGCCTTCAACCAGCTCGGCCTTGACCCGCTTCTGTTTGGTATGGATAACCAAGATG
AGGTTCAGCAAGCGTATTTGTTAGCATTAACTAGCCAATTTTTAGTGGTGGTTACGCAAGTCAATCATGA
TGAAAAATCGCTTGAGATCCTAAAAAAAGATCTCAGTTTTGATTCACCGAAAAACCTCATGGCCCTCGCG
TCAACAGGCTTTTCCCTGCAGGCAAATCAAGCCATTAACAACCATATCCAAGGGTTTAGCACCGCTTTTC
TCTCTACAAGTAATCCTAGTGATATGGTGGCGTTTGCGACCGCAATCGCTAACTGGGATACGTTCACGGG
GGATGAACGTATTCAGGAGAAAGCATGGTTTAAGAGATGGATTGAACCCGCTCAATCGAGTTTTGGTGCA
CTGCAAAAAGCGGTCGCCAATCAAGCCAAAGAGAGTTGGCAAGCGGTGATGGAGTTGCTGTTTCCTTATC
AGAATCAGCCCAAAGGAGGGACGCCCAGTTTGTTGGCTAACCTTCGTTTACTGTTGGTGGAAAGCCTAGT
TCGAGAAGAGGCGGTGCTGCAACATAACCCCAAGTATGCGGCTGAGCTTAAGCAATTTGAGACTAAGCTG
AATGCCATTTTGCAAGAGATGAATGATGCTCTGGAACTCAAACCCGGTAATGTGAGCCCGAAAAACCATC
AAATTGCGACCGCGCAATCCGCACAACGTAAGCTAGGGCAATTACTCAGTAGTGAGCTGCCGATGATGCT
GACGCTCAAAAACCAAGCTGCGATGAACACTTTTCAGCAGTCGGTAAATGAGAAACTGAGCGCGCTATCG
AAAAACGTCAAAACCAGTAGCGCGTCGGTGAGTCAGAAACTGGGTGGATTAGGGGGCTTGCTGTTTGCGT
TGAACCTATGGAATACCATGACGGTTTTGGAGAATATCCGCTATAAGGTCGCACAATACCCCAGTTGGAA
TCCTTTTAAGAACCCGGCGTTGGGCGAAGCCATTTATGCCACTGGCAACACTATTGTAGTCGCCGGTGCC
ATTAGTGCTGGGCGAGCTTGGGTGACGATTGCTGAGCAAGGGTTGTTAGATCGTACACTGAAAAACGCCT
TAAATACCACGAAAGTTTTGGGCACAAAAGATGCCCTAAAAACCTTTGCTAAATCGATCGCCTTGGTGGC
TACCGTGGGCATGATTGCCAGCGCATTAGAAACATGGGAAAGCTGGGGTAAGTTTAATGACAGCAGTAAA
ACCGATCTTGAACGCTTCGGTTATTTGTTAAAAGCTGGAGCAACGGGAGCACAGGGAATTATTTTTTATA
TTCAGTTTTTCACACTCTTAGGTAGTGGAATTGGTGGACCCTCCATAGCTGCGATTTCTGCAGGTTGGAT
GCTCGCCGGTTTTGCTGTGATTGGTATTGTCTATTTGATCGGGGTGATTTTGACCAATGTGTTTAAACGC
TCAGAGTTAGAAATTTGGTTATCAAAATCGACGTGGGGGAAAGAGAGTGCTCATTGGCCAGTGGGCAAAG
AATTGACCGAGTTAGAGCACCTTCTCCATCGTCCGAGTCTTCGGTTGAGTCAAGTTACGCAACGTAAAGC
AGCGCAATGGATGGATTCAGGTTCTTTACAATGGCAGTTGGAACTCACGTTACCCGATTATCTTAAGGGG
CAGACGATAGGCTTACAAATCACCCGTTTGCCAGCGCAGCCGGCATATTATCAACCGCAAAGGGAGGCGG
TAACACCAATACTCATCAATGAACAACAGGGCAAATGGAGTATTGAAGATAATCAGCCAGTGTATCGTAT
TACACTGGGTGGCAGTGAGAAGGATACTGTCGGAGTTTGCGTTGCACTGCCCCTGCGTTGGGGCAAGGAG
CTGAGCCTCAAATTCTATGCCAGTGGAACTCGCGCGGGGGAATTGGATTTACAATCTGCAGAGGCGAATG
ATATTGCCACAAGAAATCTCGTTGTAGGAAAAGGTTAA