SecReT6
Effector Protein ID: 365970958
rhsB
SecReT6 ID514
T6SS typeA3
Gene symbolrhsB
Locus tagEcWSU1_02666
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2748218..2752606 [-]
ProductRhsB
Effector typeProtein
Homologous effectorECL_01567
DescriptionrhsA
UniProt IDG8LFB4
KEGG IDeec:EcWSU1_02666
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 394..406
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 433..447
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 483..511
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 549..561
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 591..628
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 655..691
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 697..733
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 721..753
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 760..796
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 802..855
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 869..897
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 921..956
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 984..1009
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 1033..1065
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 1056..1084
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 1106..1135
RHS_repeat [PF05593], Evalue: 5.60E-68, Aligned region: 1147..1165
PAAR_motif [PF05488], Evalue: 1.50E-14, Aligned region: 5..15
PAAR_motif [PF05488], Evalue: 1.50E-14, Aligned region: 100..219
RHS [PF03527], Evalue: 3.50E-13, Aligned region: 737..753
RHS [PF03527], Evalue: 3.50E-13, Aligned region: 920..932
RHS [PF03527], Evalue: 3.50E-13, Aligned region: 933..946
RHS [PF03527], Evalue: 3.50E-13, Aligned region: 1116..1127
RHS [PF03527], Evalue: 3.50E-13, Aligned region: 1222..1261
DUF4150 [PF13665], Evalue: 2.80E-06, Aligned region: 105..124
DUF4150 [PF13665], Evalue: 2.80E-06, Aligned region: 165..215
DUF4150 [PF13665], Evalue: 2.80E-06, Aligned region: 1378..1422
Protein Sequence: 1462 a.a.     [Download]
>gi|365970958|ref|YP_004952519.1| RhsB [Enterobacter cloacae EcWSU1]
MSDNNAARQGDEIIHSSIFADITSIVAEGAAYAVIGAAVGAAATVAAPLLGAGAAAAGVAAIGSSCLLSG
IIGGVLANVAGITDDISNAAEGLGNALFPPSPAGKITTGSDNVLTNAIPAARAAGTLTPADTPSPEPQSP
GSFADYAGMLLSAAGQFGSEMWQPSVASAAAGTSPLEEDKVACEKHSGPQYLAEGSKSVFINGQPAVRAK
DRTTCEGTVSDDVSPNVIIGGETLTVRDIKSGKTPGLALGMIALSLLRGRPGKILKNMPCALAAAGGGML
ADMAVNAVFGSSHPVHAATGVKVLNDDDELDFSLPGRFPLRWQRSYNSLTTREGLFGLGWATTFDSYLTL
EENNAIWFDETGRELSFELPPVDRAFYSISEGIIIRRNESGDVAIADDDGAVWRLYKPTRANPTLLRLAS
LSDEYGNALLTEWDEHGRLVNLHDEPRAIDVTLRYEDERFPQRATSASHFDGNRTWPLMQWGYDARGQLA
SVTDASGVVTREYRYNDHGLMVWHRLPGGLESEYRWQKFDHWRVVENRTSTGDGCRFNYDLAAGLTTVEH
YDGQTRKHYWNAQNLIVRYVDERGENWCYEWDENELLTRRIDPLGNAVTFVYDEMGNRVQEIDADGNTRT
TTWLEHRALPSAIIEADGSATRFWYDEHHGLKRVVDPMGQTTLLRRDEFGQVVEEVDAAGNSRYQEYNEA
GQVIRATDCSGRITRYTYHPLGWLTTEIGADGEETRYRYDAAGRPVQLDRPEGWTESLAWNERGLPVTHA
GADGKESEFKYDEAGRLTATRNTQGEEVRRRWDSRGRLIALENENGEAYQFRWGADSLLLEEVGLDGVAS
QYRYDACGRTIARTFAAGHPEAITHAFAWSASGQLVARTTPEGQTRYHYTPSGLLSRIGLHPALSVDAWS
AEAEQELAFEYDALGRVTREVGEHGELAWEYDALGNRTSVTLPDGRELKQFYYGSGHLLSIALDKLSVSD
FTRDELHRETSRTQGLLTTRSEYDRLGRLHRRDVFTGNAQRPSPRRWSHRWDYDYRNNLVREERDDNPFS
WYRWQYDSAGRLLVQDGTLPGQEQWRWDAAGNPLEGSAEKVTHNRLTQLNGIRWRYDIHGRTVEKDNGQT
RWHYRYDGEHRLTEVISQPRDRNKPQTQVSFRYDPLGRRISKTRRQMLGGQPTGKPVSTRFVWEGFRLLQ
EVHGDVPLTYVYSDQDSYDPLARIDGVDAPEIFWFHCQPNGTPERMTDSEGQVRWEGVNSTWGKLLRESE
TQVSGYSQNLRMQGQYLDRETGLHYNLFRYYDPDCGRFTQQDPIGLAGGINLYQYGANSLTRIDPLGLKQ
EEVIRYMSKDEAIASASERDGKGGLVPNNRGEKAIWVNHDSRPGFNPGNEKYRAVMTVNDSGVELLNQHS
DISKVDYKETGLKDGVLSKRNEPGARGIGKNILSRFNDKITSFQIEKKDAKGNWKKCGKRIT
-
Nucleotide Sequence: 4389 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2752606-2748218 Enterobacter cloacae EcWSU1 chromosome, complete genome
ATGAGCGATAACAACGCGGCCCGTCAGGGCGACGAGATCATTCACTCCAGCATTTTTGCGGATATCACCA
GTATTGTGGCGGAAGGTGCGGCCTATGCCGTTATCGGCGCTGCCGTGGGCGCGGCGGCAACCGTTGCTGC
TCCGCTGCTGGGGGCGGGTGCCGCCGCTGCGGGCGTGGCGGCTATTGGATCCAGCTGTCTGTTAAGTGGG
ATCATTGGCGGCGTACTGGCAAACGTGGCAGGTATAACTGACGATATCAGCAACGCCGCCGAAGGCTTAG
GCAACGCGCTGTTCCCACCGTCGCCAGCGGGCAAAATCACCACCGGGTCTGATAACGTTCTGACGAACGC
GATTCCCGCTGCACGAGCGGCCGGGACGCTGACGCCCGCCGACACACCGTCACCTGAACCACAGTCTCCG
GGCAGCTTTGCCGATTACGCCGGCATGCTGCTTTCCGCCGCTGGACAGTTTGGCAGCGAGATGTGGCAGC
CGAGCGTGGCTTCTGCCGCCGCGGGAACCTCGCCGCTGGAAGAAGACAAGGTGGCGTGCGAAAAGCACTC
CGGGCCGCAGTATCTGGCGGAAGGCTCTAAAAGCGTCTTCATTAACGGGCAGCCCGCGGTACGTGCAAAA
GATCGCACCACCTGCGAAGGCACCGTTTCCGACGATGTCTCCCCGAATGTGATCATCGGCGGGGAAACGC
TCACGGTCCGCGATATCAAAAGCGGTAAAACGCCGGGTCTGGCGCTGGGGATGATTGCGCTCTCCCTGCT
GCGCGGGCGTCCGGGTAAAATCCTGAAAAATATGCCCTGTGCGCTGGCGGCAGCCGGCGGTGGTATGCTG
GCCGATATGGCCGTTAATGCTGTGTTTGGCTCCTCGCACCCGGTACATGCTGCAACCGGCGTGAAGGTGC
TGAATGATGACGATGAACTCGATTTCTCGCTGCCGGGGCGCTTCCCGCTGCGCTGGCAGCGCAGCTACAA
CAGCCTGACCACCCGTGAAGGGCTGTTTGGTCTGGGTTGGGCGACAACCTTTGACAGCTATCTGACGCTC
GAAGAGAACAACGCGATCTGGTTCGACGAAACCGGCCGTGAGCTGAGCTTTGAGCTGCCGCCCGTCGATC
GCGCGTTTTACAGCATCAGCGAAGGCATCATCATCCGCCGCAATGAGAGCGGCGACGTGGCGATTGCCGA
CGATGACGGCGCGGTATGGCGTCTGTATAAACCAACCCGGGCGAATCCCACCCTCCTGCGTCTGGCCTCC
CTCAGCGATGAATATGGCAACGCGCTGCTGACGGAGTGGGATGAACACGGCAGGCTGGTCAATCTTCACG
ATGAGCCACGGGCGATTGATGTCACCCTGCGCTATGAAGATGAGCGTTTCCCACAGCGCGCCACCTCTGC
CAGCCATTTTGACGGCAACCGTACCTGGCCGCTGATGCAGTGGGGTTACGATGCGCGCGGCCAGCTGGCG
AGCGTGACGGATGCCTCTGGCGTAGTGACGCGCGAATACCGCTATAACGACCACGGCCTGATGGTCTGGC
ACCGCCTGCCGGGCGGGCTGGAGAGCGAATACCGCTGGCAAAAATTCGACCACTGGCGTGTGGTGGAAAA
CCGCACCAGCACCGGCGACGGCTGCCGTTTTAACTATGATTTAGCCGCCGGGCTGACGACCGTCGAGCAC
TATGATGGCCAGACGCGTAAGCACTACTGGAACGCGCAAAATCTGATTGTCCGCTACGTTGACGAGCGCG
GTGAAAACTGGTGCTACGAGTGGGATGAAAACGAACTTCTGACCCGTCGCATCGATCCGCTCGGTAACGC
CGTCACCTTCGTCTACGACGAAATGGGCAACCGGGTGCAGGAAATCGACGCCGACGGCAATACCCGCACC
ACCACCTGGCTGGAGCACCGCGCGCTGCCGTCAGCCATCATTGAAGCCGACGGCAGTGCGACCCGTTTCT
GGTACGACGAACATCACGGGCTGAAGCGTGTGGTAGACCCGATGGGGCAGACAACACTGCTGCGCCGGGA
CGAGTTTGGTCAGGTCGTTGAAGAAGTTGATGCCGCGGGAAACAGTCGCTACCAGGAGTACAACGAGGCC
GGGCAGGTCATTCGTGCCACAGACTGTTCAGGACGAATAACCCGCTATACCTATCATCCGCTGGGCTGGT
TAACGACTGAGATCGGCGCTGACGGCGAAGAGACGCGCTATCGCTACGATGCCGCAGGGCGTCCGGTGCA
ACTCGATCGACCGGAAGGCTGGACAGAGTCGCTCGCATGGAACGAACGCGGCCTGCCGGTGACGCATGCG
GGCGCTGATGGCAAAGAAAGTGAGTTTAAATACGACGAGGCAGGACGATTAACCGCTACGCGTAATACTC
AGGGTGAAGAGGTCCGCCGCCGCTGGGACAGCCGCGGGCGACTGATTGCCCTGGAAAACGAAAACGGCGA
AGCGTACCAGTTCCGCTGGGGTGCGGACTCGCTGCTGCTGGAAGAGGTGGGGCTCGATGGCGTGGCCTCA
CAGTATCGCTATGACGCCTGCGGGCGTACGATAGCGCGCACGTTTGCCGCCGGTCATCCGGAAGCCATCA
CCCATGCCTTCGCCTGGAGCGCGAGTGGCCAGCTGGTTGCCCGCACCACGCCGGAAGGGCAGACCCGTTA
TCACTACACACCGTCAGGTTTGCTGAGTCGTATTGGACTTCATCCGGCACTTTCCGTTGACGCCTGGAGT
GCAGAGGCAGAACAGGAACTTGCCTTTGAGTATGACGCCCTGGGGCGTGTCACGCGTGAAGTGGGCGAGC
ACGGTGAGCTGGCATGGGAGTATGATGCTCTCGGCAACCGCACCTCCGTCACGCTGCCCGATGGCCGCGA
GCTGAAACAGTTCTACTACGGCAGCGGGCATCTGCTCAGCATTGCCCTCGATAAGCTGTCGGTCTCTGAT
TTTACCCGTGACGAACTCCACCGTGAGACCAGCCGCACCCAGGGGCTGCTGACCACCCGCAGCGAGTACG
ACCGTCTTGGTCGACTGCATCGCCGGGATGTATTCACTGGCAATGCCCAACGTCCGTCGCCGCGCCGCTG
GTCCCACCGCTGGGATTATGACTACCGCAATAACCTGGTGCGGGAAGAGCGGGACGATAACCCGTTCAGC
TGGTACCGCTGGCAGTACGACAGCGCCGGGCGTTTGCTTGTTCAGGACGGAACGCTGCCCGGCCAGGAGC
AGTGGCGCTGGGATGCTGCCGGTAACCCGCTGGAAGGGTCTGCTGAGAAGGTCACGCACAACCGCCTGAC
GCAACTGAACGGCATTCGCTGGCGCTATGACATCCACGGCCGCACCGTGGAGAAAGATAACGGCCAGACC
CGCTGGCACTACCGCTACGACGGTGAGCACCGTCTGACGGAAGTCATCAGCCAGCCGCGGGACCGTAACA
AACCGCAGACGCAGGTCAGCTTCCGCTACGATCCGCTTGGGCGACGCATCAGCAAAACGCGACGCCAGAT
GCTGGGCGGACAGCCAACCGGCAAGCCGGTCAGCACCCGGTTTGTCTGGGAAGGTTTCCGCCTGCTGCAG
GAAGTGCACGGGGACGTGCCGCTAACCTACGTCTACAGCGATCAGGACAGCTACGATCCGCTGGCGCGTA
TCGACGGCGTTGATGCCCCGGAGATCTTCTGGTTCCACTGCCAGCCCAACGGTACGCCGGAGCGGATGAC
GGATAGCGAAGGGCAGGTGCGCTGGGAAGGGGTGAACAGCACCTGGGGCAAGCTGCTACGGGAAAGCGAG
ACGCAGGTATCAGGATATTCTCAGAACCTGCGCATGCAGGGGCAATACCTGGACCGTGAGACAGGGCTGC
ACTACAATCTGTTCCGGTATTACGACCCGGACTGCGGTAGGTTTACGCAGCAGGACCCGATAGGGCTGGC
GGGGGGGATAAACCTTTACCAGTATGGTGCAAATAGTTTAACCCGAATAGACCCTCTGGGATTAAAACAA
GAGGAAGTTATACGCTATATGAGTAAAGATGAAGCGATTGCATCAGCTTCTGAACGTGATGGTAAAGGCG
GATTGGTTCCTAATAATCGTGGTGAAAAAGCCATATGGGTTAATCATGATAGCCGACCAGGGTTTAACCC
TGGAAATGAAAAGTATCGTGCCGTTATGACCGTAAATGACTCTGGGGTTGAGCTTCTTAATCAACATAGT
GATATATCAAAAGTTGATTACAAAGAAACCGGGCTGAAAGATGGAGTTCTATCAAAGAGAAATGAACCTG
GAGCAAGGGGCATCGGTAAAAATATCCTTTCTCGTTTTAATGATAAAATCACTTCATTCCAGATTGAAAA
GAAAGATGCTAAAGGTAATTGGAAGAAATGTGGTAAGAGGATTACTTAA