SecReT6
Effector Protein ID: 365970981
hcp1
SecReT6 ID514
T6SS typeA3
Gene symbolhcp1
Locus tagEcWSU1_02689
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2780226..2780834 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDG8LFD7
KEGG IDeec:EcWSU1_02689
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.40E-38, Aligned region: 48..178
Protein Sequence: 202 a.a.     [Download]
>gi|365970981|ref|YP_004952542.1| hypothetical protein EcWSU1_02689 [Enterobacter cloacae EcWSU1]
MCFRQAGGRGKIWTVLFSPMLSCLPYKCFFESNIVHPRRVDIMAIDMFLKVEGVTGESKDSNHTGWTDIT
SFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAILKHCASGKHLTKVELSVCKAGGQQVEYTR
ITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTTAGGKGAESSAGWNIKENKEA
-
Nucleotide Sequence: 609 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2780834-2780226 Enterobacter cloacae EcWSU1 chromosome, complete genome
ATGTGTTTTCGTCAGGCTGGAGGCAGAGGTAAAATATGGACGGTTTTATTCAGCCCCATGCTTTCCTGTT
TGCCATATAAGTGCTTTTTCGAAAGCAATATTGTTCATCCACGAAGAGTAGATATTATGGCTATTGATAT
GTTTCTGAAGGTCGAGGGTGTTACGGGCGAATCTAAAGATTCTAACCACACCGGCTGGACTGATATTACC
TCCTTCTCCTGGGGCGCTTCCCAGCCAGGTAATATGAGTGTTGGTGGCGGCGGCGGTGCCGGTAAAGTTA
ACTTTAACGATCTGCACGTTAACGCTCTGATCGACAAATCCACTACAGCAATTCTCAAACACTGCGCAAG
CGGTAAGCACCTGACTAAAGTTGAACTGTCCGTGTGCAAAGCGGGTGGTCAGCAAGTAGAATATACCCGC
ATCACGCTGGAAGATGTGCTGGTAACTTCTGTTCAGTACACCGGTGCAGACAACGGCGACACCGTTGGTG
TGACCTATGCATTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGACCACTGCTGGTGGTAAAGG
TGCTGAAAGCAGCGCTGGCTGGAACATTAAAGAAAACAAAGAAGCGTAA