SecReT6
Effector Protein ID: 374333545
hcp1
SecReT6 ID534
T6SS typeA3
Gene symbolhcp1
Locus tagPSE_p0124
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016646] [Browse all T6SS(s) in this replicon]
Location [Strand]137273..137848 [-]
ProductType VI secretion system effector, Hcp1
Effector typeProtein
Homologous effectoridrA
DescriptionHcp protein
UniProt IDG8PVB8
KEGG IDpsf:PSE_p0124
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.20E-37, Aligned region: 26..176
Protein Sequence: 191 a.a.     [Download]
>gi|374333545|ref|YP_005086673.1| Type VI secretion system effector, Hcp1 [Pseudovibrio sp. FO-BEG1]
MAGLPIFIEWGLFIDFKEHVMPTPAYISIEGSTQGPITQGAFTEDSVGNVWQEGHEDEIMVQQIDHTVII
PRDPQSGQPAGQRVHTPFKFTCSMNKSIPLLYNALCTGEMLPKCEVKWYRTNSSGKQEHFFTTTLEDALV
TNIECDLPHCQDPKNADFTQLLTIELSYRKIMWEHTVSGTSGADDWRAPAA
-
Nucleotide Sequence: 576 bp     [Download]
>gi|374333421|ref|NC_016646.1|:c137848-137273 Pseudovibrio sp. FO-BEG1 plasmid unnamed, complete sequence
ATGGCGGGGCTGCCCATTTTTATTGAATGGGGTTTATTCATTGATTTTAAGGAGCATGTAATGCCAACTC
CCGCTTATATCAGCATTGAAGGGTCAACCCAGGGTCCAATTACTCAAGGTGCGTTCACCGAAGATTCTGT
CGGTAACGTATGGCAGGAAGGCCATGAAGATGAAATCATGGTGCAGCAGATTGATCATACAGTGATCATT
CCGCGTGACCCACAGTCCGGCCAGCCTGCAGGTCAGCGTGTGCATACACCGTTCAAATTCACTTGCTCCA
TGAACAAGTCCATCCCTCTGCTGTACAACGCCCTGTGCACCGGTGAGATGCTGCCAAAGTGTGAAGTGAA
ATGGTATCGCACCAACTCTTCCGGCAAGCAGGAACACTTCTTCACCACCACATTGGAAGATGCACTAGTC
ACCAACATCGAGTGTGATCTGCCGCATTGTCAGGATCCAAAAAACGCTGACTTCACTCAGCTTCTGACCA
TTGAACTTTCCTACCGCAAAATCATGTGGGAACACACCGTCTCCGGCACTTCCGGCGCTGACGACTGGCG
TGCGCCAGCAGCTTAA