SecReT6
Effector Protein ID: 375131026
-
SecReT6 ID530
T6SS typeA1
Gene symbol-
Locus tagvfu_A01957
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016602] [Browse all T6SS(s) in this replicon]
Location [Strand]2052205..2054271 [-]
ProductvgrG protein
Effector typeProtein
Homologous effectorVC1416
Descriptiontype VI secretion system Vgr family protein
UniProt IDF0LU99
KEGG IDvfu:vfu_A01957
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-66, Aligned region: 40..339
Phage_base_V [PF04717], Evalue: 2.10E-23, Aligned region: 379..472
Phage_base_V [PF04717], Evalue: 2.10E-23, Aligned region: 573..588
Gp5_C [PF06715], Evalue: 0.0023, Aligned region: 532..546
Gp5_C [PF06715], Evalue: 0.0023, Aligned region: 537..552
Gp5_C [PF06715], Evalue: 0.0023, Aligned region: 556..569
DUF2345 [PF10106], Evalue: 0.0036, Aligned region: 582..625
Protein Sequence: 688 a.a.     [Download]
>gi|375131026|ref|YP_004993126.1| vgrG protein [Vibrio furnissii NCTC 11218]
MATLKYQFHVEGLEDDTLVVRGFDGQETLSSERMNGQLLNEQLCHGFRYELELASRLANLTPDMVVDKVA
ELTLYRDDMLVQRVNGIVRRFTQGDTGHHHAFYSLTLVPALERLSLRHNSRIFQLNTVPEILSILLQEMG
INDYAFALTRDCAQREFCVQYRETDLDFLHRLAAEEGLVYSFIHEEGKHTLIFSDASDSLSKLGEPIPYN
TLAGGMIESPYISALSVHTQSEVSQTALQDYSFKKPTYSFAQQAVGTEMEYQQPDYEHFDAPGRYKDDVS
GKAFSQIRLDYLRRNARTATGKSNQPLLRPGVKFDLKEHLDDTLNRDWLVVRVTCQGTQPQALEEAGGNG
ATTYANQFTLLPAHRTWRATPQAKSQVDGPMIATVVGPEGEEIFCDEYGRVKLHFPWDRYSNGDEHSSCW
VRVSQGWAGSQYGMIAIPRIGHEVIVSFLNGDPDQPIVTGRTYHATNTAPYTLPDNKTKTVLRTETHQGQ
GYNELSFEDQAGSEQVYLHAQKDFDGLIENDHTSVIQHDKHLTVENDRFTQIKNNQHLTVGGESRESVTG
NRTLMVKGSLHVKTGSVWVNESGTEVHIKAGQKVVIEAGSEITVKAGGSFVKVDPAGVHLSGAGVNLNSG
GSPGSGSGFSGQAATLPGNLDDAPPLDAPKTVSYQALLQAEEANVPAVKPCPLAEGNS
-
Nucleotide Sequence: 2067 bp     [Download]
>gi|375129161|ref|NC_016602.1|:c2054271-2052205 Vibrio furnissii NCTC 11218 chromosome 1, complete sequence
ATGGCGACGTTAAAGTATCAGTTTCATGTGGAAGGTCTGGAGGACGACACGCTGGTGGTGCGTGGGTTCG
ACGGGCAGGAAACCCTGTCCAGCGAACGCATGAATGGGCAGCTATTGAATGAACAGCTATGCCACGGTTT
TCGTTATGAACTGGAATTGGCCAGTCGGCTTGCTAATTTAACGCCCGATATGGTGGTAGATAAAGTCGCA
GAGCTGACGCTCTATCGCGACGATATGCTGGTTCAGCGCGTGAACGGCATCGTGCGCCGCTTTACTCAGG
GCGATACCGGCCATCACCACGCCTTCTATTCACTCACGTTGGTGCCTGCTTTAGAGCGTTTGTCTCTGCG
CCACAACAGCCGCATTTTCCAACTCAACACTGTGCCGGAAATCCTCTCCATCCTGCTACAAGAAATGGGG
ATTAACGACTACGCCTTTGCGCTGACTCGCGACTGCGCGCAGCGTGAATTCTGCGTTCAGTACCGTGAAA
CCGACTTAGATTTTCTCCATCGCCTGGCGGCTGAAGAAGGGCTGGTGTACAGCTTCATTCATGAAGAAGG
CAAGCACACGCTGATATTCAGCGACGCCTCCGACAGCCTGTCGAAACTCGGCGAGCCAATCCCGTACAAT
ACGCTGGCAGGCGGCATGATTGAATCGCCGTATATCTCGGCGCTGAGCGTGCACACCCAATCGGAGGTGA
GCCAGACGGCGCTGCAGGATTACAGTTTCAAAAAACCGACATACTCGTTTGCCCAGCAAGCGGTCGGGAC
AGAAATGGAGTACCAGCAGCCAGATTACGAACATTTCGATGCGCCGGGGCGGTATAAAGACGATGTTAGC
GGTAAAGCATTCAGCCAGATCCGCCTCGATTACCTGCGCCGCAACGCGCGCACCGCAACGGGTAAAAGCA
ACCAGCCGCTGCTGCGTCCGGGCGTGAAGTTTGACCTGAAAGAGCACCTCGACGACACCTTAAACCGAGA
TTGGTTGGTGGTGCGTGTCACCTGCCAAGGTACGCAGCCTCAAGCGCTGGAAGAAGCGGGCGGCAATGGT
GCGACCACCTACGCGAACCAATTCACATTGCTCCCGGCGCATCGCACTTGGCGCGCCACACCGCAAGCCA
AATCTCAGGTTGATGGCCCGATGATCGCCACAGTCGTAGGCCCAGAAGGCGAAGAGATCTTCTGTGATGA
GTACGGCCGCGTAAAACTGCATTTTCCATGGGATCGCTACTCCAACGGTGATGAGCACAGCTCGTGCTGG
GTGCGCGTCTCGCAAGGTTGGGCGGGCAGCCAATACGGCATGATTGCCATTCCGCGCATTGGACATGAAG
TGATTGTGTCGTTTCTCAATGGCGACCCCGATCAACCGATTGTCACCGGCCGTACCTATCACGCCACCAA
CACCGCGCCATATACGCTGCCAGACAACAAAACCAAAACCGTGCTGCGCACCGAAACCCATCAGGGTCAG
GGCTATAACGAACTCAGTTTTGAAGACCAGGCCGGCAGTGAGCAAGTTTACCTGCACGCGCAGAAAGACT
TTGATGGCCTGATTGAAAACGACCACACCAGCGTCATTCAACACGACAAACACCTCACGGTGGAGAACGA
CCGCTTTACTCAAATTAAAAACAATCAGCATCTGACGGTGGGCGGCGAAAGCCGTGAATCAGTGACCGGA
AATCGAACTCTGATGGTTAAAGGTTCATTGCATGTGAAAACCGGCAGTGTTTGGGTGAATGAATCGGGTA
CTGAAGTCCATATTAAAGCGGGCCAAAAGGTCGTCATTGAAGCTGGCTCCGAAATCACCGTGAAAGCGGG
CGGCAGCTTTGTGAAAGTCGACCCGGCAGGGGTTCATCTTTCAGGTGCAGGTGTGAACCTGAACTCGGGC
GGTAGCCCGGGCAGTGGCAGTGGTTTCAGTGGCCAAGCTGCCACACTACCGGGCAATTTGGACGATGCGC
CGCCACTGGATGCTCCGAAAACGGTGTCTTACCAAGCTTTGTTGCAGGCAGAGGAAGCCAATGTGCCTGC
AGTGAAACCTTGTCCACTCGCGGAGGGTAATTCATGA