SecReT6
Effector Protein ID: 375133122
-
SecReT6 ID530
T6SS typeA1
Gene symbol-
Locus tagvfu_B01010
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]1055989..1056507 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDF0LUA0
KEGG IDvfu:vfu_B01010, vfu:vfu_A01958
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.50E-37, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|375133122|ref|YP_005049530.1| type VI secretion system effector [Vibrio furnissii NCTC 11218]
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHIVTVPTDPQSGQPSGQRVHKPFKF
TVSLNKAVPLLYNALASGEKMTTVELKWYRTSIEGKQENFFTTKLENASIVDIQCEMPHCQDPAKSDFTQ
NLTVSMSYRKITWDHVNAGTSGSDDWRKPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|375132168|ref|NC_016628.1|:1055989-1056507 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGCCAACTCCATGTTATATCTCTATCGAAGGTCAAACTCAGGGTCTTATCACTGCAGGCGCTTGTACTG
CGGATTCTATCGGCGATTCATTCGTTGAAGGTCATGAAGACGAAATGCTGGTTCAGCAGTTCGACCACAT
CGTCACTGTACCGACTGACCCACAATCAGGTCAGCCTTCAGGTCAACGTGTGCACAAACCATTCAAATTC
ACTGTGTCTCTGAACAAAGCCGTTCCTCTGCTGTACAACGCACTGGCTTCAGGCGAGAAGATGACGACTG
TTGAACTGAAATGGTACCGCACGTCTATCGAAGGCAAACAAGAAAACTTCTTCACCACCAAGCTGGAAAA
CGCGTCTATCGTGGATATCCAGTGTGAAATGCCACACTGTCAAGATCCAGCAAAATCTGATTTCACTCAG
AACCTGACTGTTTCGATGTCTTACCGCAAAATCACGTGGGATCACGTGAACGCGGGTACTTCAGGCTCAG
ACGATTGGCGTAAACCAGTCGAAGCGTAA