SecReT6
Effector Protein ID: 375133123
-
SecReT6 ID530
T6SS typeA1
Gene symbol-
Locus tagvfu_B01011
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]1056659..1058755 [+]
ProductvgrG protein
Effector typeProtein
Homologous effectorVCA0018
Descriptiontype VI secretion system Vgr family protein
UniProt IDF0LZ62
KEGG IDvfu:vfu_B01011
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.60E-64, Aligned region: 38..334
Phage_base_V [PF04717], Evalue: 2.40E-23, Aligned region: 374..467
Phage_Mu_Gp45 [PF06890], Evalue: 0.0039, Aligned region: 426..453
Phage_Mu_Gp45 [PF06890], Evalue: 0.0039, Aligned region: 576..618
Protein Sequence: 698 a.a.     [Download]
>gi|375133123|ref|YP_005049531.1| vgrG protein [Vibrio furnissii NCTC 11218]
MATLKYQFHVEGLEDDTLVVRGFDGQETLSSERINGQLCHGFRYELELASRLANLTPEMVVDKVAELTLY
RDDVLVQRVNGIVRRFTQGDTGHHHTFYSLTLVPALERLSLRHNSRIFQLNTVPEILSILLQEMGINDYA
FALTRDCAQREFCVQYRETDLDFLHRVAAEEGLVYSFIHEEGKHTLIFSDASDSLPKLGEPIPYNTLAGG
MIESPYISALSVHTQSEVSQTALQDYSFKKPTYAFAQQAVGTEMAYQQPDYEHFDAPGRYKDDVSGKAFS
QIRLDYLRRNAHTATGKSNQPLLRPGVKFDLQEHLDDTLNRDWLVVRVTCQGTQPQALEEAGGNGATTYA
NQFSLIPAHRTWRATPQAKPQVDGPMIATVVGPEGEEIFCDEHGRVKLHFPWDRYSNGDEHSSCWVRVSQ
GWAGSQYGMIAIPRIGHEVIVSFLNGDPDQPIVTGRTYHATNTAPYTLPDNKTKTVLRTETHQGQGYNEL
SFEDQAGSEQIYLHAQKDFDGLIENDHTRVIKHDKHLTVENDRFTQIKNNQHLTVGGESRTKIALDQSIE
IGGSLHQKVADKTIFDSGNEVHLKAGNKLVLDAGSELTIKAAGSFIKVDAGGVHVVGSAINLNSGGSAGS
GSGYGGQVAELPSGVEAQAVPEEMLRAPMSATMSSLLPAVATLDLPVIELCQKRADGSCPKANCECTQ
-
Nucleotide Sequence: 2097 bp     [Download]
>gi|375132168|ref|NC_016628.1|:1056659-1058755 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGGCGACGTTAAAGTATCAGTTTCATGTGGAAGGTCTGGAGGACGACACGCTGGTGGTGCGTGGGTTCG
ACGGGCAGGAAACCCTGTCCAGCGAACGCATCAATGGGCAGCTATGCCACGGTTTTCGTTATGAACTGGA
ATTGGCCAGTCGGCTTGCCAATTTAACGCCGGAGATGGTGGTAGATAAAGTCGCGGAGCTGACGCTCTAT
CGCGACGATGTGCTGGTTCAACGCGTGAACGGCATCGTGCGCCGCTTTACTCAGGGCGATACCGGCCATC
ACCACACCTTCTATTCACTCACGTTGGTGCCTGCTTTAGAGCGTTTGTCTCTGCGCCACAACAGCCGCAT
TTTCCAACTCAACACTGTGCCGGAAATCCTCTCCATCCTGCTACAAGAAATGGGCATCAACGACTACGCC
TTTGCGTTGACCCGCGACTGCGCGCAGCGTGAATTCTGCGTTCAGTACCGTGAAACCGACTTAGATTTTC
TCCATCGTGTAGCGGCCGAAGAAGGGTTGGTGTACAGCTTCATTCATGAAGAGGGCAAACACACGCTGAT
ATTCAGCGACGCCTCAGATAGCCTACCGAAGCTCGGTGAGCCAATCCCATACAATACGCTGGCAGGCGGC
ATGATTGAATCGCCCTACATCTCGGCGCTGAGCGTGCACACCCAATCGGAGGTGAGTCAAACGGCGCTGC
AAGATTACAGCTTCAAAAAGCCGACATACGCCTTTGCCCAGCAAGCGGTCGGGACCGAAATGGCCTACCA
GCAACCTGATTATGAACATTTCGATGCGCCGGGGCGGTATAAAGACGATGTTAGCGGTAAAGCATTCAGC
CAGATCCGCCTTGATTATCTGCGCCGCAACGCGCACACCGCAACGGGCAAAAGCAATCAACCGTTGCTGC
GTCCGGGGGTGAAGTTTGACCTGCAAGAGCACCTCGACGACACCTTAAACCGAGATTGGTTGGTGGTGCG
TGTCACCTGCCAAGGTACGCAGCCTCAGGCGCTGGAAGAAGCGGGTGGCAATGGCGCGACCACCTATGCG
AACCAATTCTCGCTCATCCCGGCGCATCGCACTTGGCGCGCTACGCCGCAAGCTAAACCTCAGGTTGATG
GCCCGATGATTGCAACAGTCGTTGGCCCAGAAGGCGAAGAGATATTCTGTGATGAACACGGCCGCGTAAA
ACTGCATTTCCCGTGGGATCGCTATTCCAACGGTGATGAGCACAGCTCGTGCTGGGTGCGCGTCTCGCAA
GGTTGGGCGGGCAGTCAATATGGCATGATCGCCATTCCGCGCATCGGTCATGAAGTGATTGTGTCGTTTC
TCAATGGCGACCCCGATCAACCTATTGTCACCGGCCGTACCTATCACGCCACCAACACCGCGCCATATAC
GCTACCGGATAATAAAACCAAAACTGTGCTGCGCACCGAAACCCATCAGGGGCAGGGTTATAACGAACTC
AGTTTTGAAGACCAAGCGGGCAGCGAACAAATTTACCTGCACGCACAGAAAGACTTTGACGGCCTGATTG
AAAACGACCACACCCGTGTGATTAAGCACGACAAACACCTCACGGTGGAGAACGATCGTTTTACTCAAAT
CAAAAACAATCAGCATCTGACGGTGGGCGGCGAAAGCCGCACCAAAATCGCGTTAGACCAAAGCATTGAA
ATCGGCGGTTCGTTGCATCAGAAAGTGGCCGATAAGACCATTTTCGACTCCGGTAACGAAGTGCACCTTA
AAGCGGGCAACAAGTTGGTCCTCGACGCGGGCAGCGAACTCACCATCAAAGCCGCAGGCAGCTTTATCAA
AGTCGATGCCGGCGGCGTGCATGTGGTTGGTTCTGCAATCAACCTCAACTCTGGTGGCAGCGCCGGATCC
GGCTCGGGTTATGGTGGGCAAGTGGCTGAACTGCCTAGTGGCGTTGAAGCTCAAGCGGTGCCAGAGGAAA
TGCTACGCGCTCCAATGTCAGCGACGATGTCGAGTCTACTACCTGCTGTTGCTACATTGGACTTACCTGT
AATAGAGCTTTGTCAAAAAAGAGCAGATGGAAGTTGTCCAAAGGCGAATTGCGAGTGTACTCAATGA