SecReT6
Effector Protein ID: 375134259
-
SecReT6 ID520
T6SS typeA4b
Gene symbol-
Locus tagBDGL_000641
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]674859..675362 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorA1S_1296
DescriptionHcp protein
UniProt IDF0KJP8
KEGG IDacc:BDGL_000641
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|375134259|ref|YP_004994909.1| hypothetical protein BDGL_000641 [Acinetobacter calcoaceticus PHEA-2]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATS
PKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYN
QQDINGTAKGAVTKKWSLSNNTASYAA
-
Nucleotide Sequence: 504 bp     [Download]
>gi|375133618|ref|NC_016603.1|:674859-675362 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAGTCTCGTGACTCTGAGCACA
AAGGCTGGTTAGAAGTTAACTCTTGGTCTCATAACATTCGTCAACCTAAATCTGCTACTTCAAGTAGTGT
TGGTGGTCATACTGCTGAACGTGTTGAACATTCAGATATGGTTTTTGTTAAAGATCTAGATGCAACTAGC
CCGAAATTATGGGAAGCATGTTCAGCTGGTTATACATTTGATGAAGTACAAATTGACTTCTACCGTGCAA
ATGGTGATAAGCGCATCAAGTACTTACAAATCAAATTGAAGCATGTTCTAGTTTCGAGTGTAACTCCAAC
AGTTAATGAAGAAGGTGTTCCAACAGAAGCGTTTGGTTTGAAATACGCAGCTGTTGAATGGACTTACAAT
CAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAACAATACTGCTT
CTTACGCAGCGTAA