SecReT6
Effector Protein ID: 37524384
-
SecReT6 ID50
T6SS typeA1
Gene symbol-
Locus tagplu0373
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]401704..402222 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDQ7N9G3
KEGG IDplu:plu0373
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.40E-36, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|37524384|ref|NP_927728.1| hypothetical protein plu0373 [Photorhabdus luminescens subsp. laumondii TTO1]
MPTPCYISITGKTQGNITAGSFTAESVGNIYVQGHEDEMLVQAFDHVVTVPTDPQSGQPSGQRAHKPFRF
TVALNKSVPLLYNALASGEMLTSVVLKWYRTSVEGKQEHFFTTQLEDATIIDIDCQMPHCQDPTKAEFTQ
LVRVSLSYRKINWEHTTAGTSGADDWRAPIVA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|37524032|ref|NC_005126.1|:401704-402222 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGCCAACTCCATGTTATATTTCTATCACCGGAAAAACACAGGGTAATATTACTGCGGGTTCATTCACTG
CTGAATCAGTGGGTAATATTTACGTTCAGGGCCACGAAGATGAAATGCTAGTTCAAGCATTTGATCATGT
CGTCACCGTACCCACTGATCCTCAATCAGGTCAGCCTTCAGGTCAGCGTGCTCATAAACCATTCCGTTTT
ACAGTTGCATTAAATAAATCTGTTCCATTGCTTTATAACGCATTGGCTTCGGGTGAAATGCTGACGAGTG
TAGTATTGAAATGGTATCGCACTTCTGTTGAAGGGAAACAAGAGCATTTCTTCACGACGCAGTTGGAAGA
TGCCACTATTATCGACATTGATTGCCAAATGCCTCATTGTCAGGACCCAACAAAAGCTGAATTTACTCAG
CTGGTTCGTGTTTCTCTGTCTTATCGTAAGATTAATTGGGAGCATACAACCGCAGGTACTTCCGGCGCAG
ATGATTGGCGTGCACCTATTGTTGCCTGA