SecReT6
Effector Protein ID: 375260551
SecReT6 ID522
T6SS typeA2
Gene symbol-
Locus tagKOX_18800
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4062708..4063199 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDG8W9B9
KEGG IDkox:KOX_18800
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|375260551|ref|YP_005019721.1| type VI secretion system effector [Klebsiella oxytoca KCTC 1686]
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDASSP
YLYKAVTTGQTLKSAEFRWYKINDAGQEVEYFNTKLENVKVVKVNPLMHDVKDPSYEKHNHLEQIELRYE
KITWTYKDGNIIHSDSWNERATA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|375256816|ref|NC_016612.1|:4062708-4063199 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGCAATTCCAGTCTATCTGTGGCTGAAGGACGACGGCGGCGCGGACATCAAAGGTTCCGTGGACGTGA
AGGACCGCGAGGGCAGCATCGAGGTGGTGGCGCAGGAGCATAACCTGTACATCCCGACCGACAACAACAC
CGGGAAGCTGACCGGCACGCGTATCCACACGCCGTTCTTGTTCACCAAGGAAATCGACGCCTCCAGCCCG
TACCTGTACAAGGCGGTGACCACCGGCCAGACGCTGAAGTCGGCGGAGTTCCGCTGGTACAAAATCAACG
ACGCCGGTCAGGAAGTGGAGTACTTCAACACGAAGCTTGAGAACGTGAAGGTGGTGAAGGTCAACCCGCT
GATGCACGACGTCAAGGACCCGTCCTACGAGAAGCATAACCACCTCGAGCAGATTGAGCTGCGTTACGAA
AAAATCACCTGGACCTACAAGGACGGCAACATCATTCATTCCGACAGCTGGAACGAACGCGCCACCGCCT
GA