SecReT6
Effector Protein ID: 375261291
-
SecReT6 ID523
T6SS typeA2
Gene symbol-
Locus tagKOX_22510
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4846160..4846510 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDG8WIX3
KEGG IDkox:KOX_22510
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.40E-29, Aligned region: 6..116
Protein Sequence: 116 a.a.     [Download]
>gi|375261291|ref|YP_005020461.1| hypothetical protein KOX_22510, partial [Klebsiella oxytoca KCTC 1686]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVSP
-
Nucleotide Sequence: 351 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c4846510-4846160 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGACGGCGGTGCGGACATTAAAGGATCTGTGGACGTTC
AGGATCGCGAGGGCAGCATCGAAGTTGTCGCTCAGGAGCATAACCTGTACATCCCGACCGATAACAACAC
CGGCAAACTGACCGGCACCCGTATCCACACGCCGTTCCTGTTCACCAAGGAAATCGACTCGTCCAGCCCG
TATCTGTACAAGGCGGTGACCACCGGTCAGACCCTCAAGTCTGCGGAATTCAAGTGGTACAAGATCAACG
ACGCGGGCCAGGAAGTGGAGTACTTCAACACCAAACTCGAAAACGTGAAGGTGGTGAAAGTGAGCCCCTG
A