SecReT6
Effector Protein ID: 37527137
-
SecReT6 ID52
T6SS typeA2
Gene symbol-
Locus tagplu3254
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]3855299..3855790 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDQ7N244
KEGG IDplu:plu3254
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.30E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|37527137|ref|NP_930481.1| hypothetical protein plu3254 [Photorhabdus luminescens subsp. laumondii TTO1]
MAIPAYLWLKDDGGADIKGSVEVRGREGSIEIVALEHMLHIPTDNNTGKLTGTRVHAPLVFTKEVDASSP
YLYKAVTTGQTLKSAEIKWYNIDDAGQEKEYFITQLDNVKVVKVAPLMHDIKDPTKEKHNHLERIELRYE
KITWTYKDGNIIHADAWNERTTA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c3855790-3855299 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGGCGATTCCCGCTTATTTATGGCTGAAAGATGACGGCGGTGCTGACATCAAGGGCTCTGTCGAGGTAC
GGGGCCGGGAAGGTAGTATTGAAATTGTGGCGTTGGAACATATGTTGCACATCCCGACGGACAACAATAC
CGGCAAACTGACGGGGACCCGTGTGCATGCCCCATTGGTATTCACCAAAGAGGTGGATGCATCAAGTCCC
TATTTGTATAAAGCGGTCACCACCGGCCAGACCCTGAAATCTGCTGAAATCAAATGGTACAACATTGACG
ACGCAGGTCAGGAGAAAGAGTACTTCATCACCCAACTGGACAACGTGAAGGTGGTGAAAGTGGCACCGCT
GATGCATGACATCAAAGACCCTACCAAAGAGAAGCACAACCATCTGGAACGCATTGAGTTGCGTTACGAA
AAAATCACCTGGACCTACAAAGACGGCAACATCATTCATGCTGATGCGTGGAATGAGCGCACGACGGCGT
AA