SecReT6
Effector Protein ID: 37528047
SecReT6 ID53
T6SS typeN/A
Gene symbol-
Locus tagplu4211
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]4925955..4926446 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDQ7MZR6
KEGG IDplu:plu4211
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.60E-35, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|37528047|ref|NP_931392.1| hypothetical protein plu4211 [Photorhabdus luminescens subsp. laumondii TTO1]
MAIPAYLWLKDDGGADIKGSVDVHNREGSIEVVALEHALHIPTDNNTGKLTGTRVHAPLVFTKEVDASSP
YLYKAVTTGQTLKSAEFKWYQIDDAGQEKVYFITHLNNVKVVKVAPLMHDIKDPTKEKHNHLERVELRYE
KITWTYKDGNIIHSDAWNERSQA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c4926446-4925955 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGGCAATCCCTGCGTATTTATGGTTGAAAGATGACGGCGGTGCCGACATTAAAGGTTCGGTGGATGTAC
ACAACCGGGAAGGCAGTATTGAGGTGGTGGCGCTGGAACATGCGCTACATATCCCGACGGATAACAATAC
CGGCAAGCTGACCGGCACCCGTGTGCATGCGCCGCTGGTGTTTACTAAAGAGGTCGATGCGTCTAGCCCG
TATCTGTATAAAGCGGTGACAACGGGTCAGACCCTGAAATCGGCGGAATTCAAATGGTACCAAATTGATG
ATGCTGGTCAGGAGAAGGTCTATTTCATCACTCATCTGAACAACGTGAAGGTGGTGAAAGTGGCACCGTT
GATGCATGACATCAAAGATCCGACTAAAGAGAAGCACAACCATCTGGAACGTGTCGAACTTCGTTACGAA
AAAATCACTTGGACGTACAAAGACGGCAACATCATTCACTCTGATGCGTGGAATGAGCGCAGTCAGGCGT
AA