SecReT6
Effector Protein ID: 375358282
-
SecReT6 ID926
T6SS typeC
Gene symbol-
Locus tagBF638R_1988
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2345779..2346774 [-]
Productputative transmembrane protein
Effector typeProtein
Homologous effectorBf638R_1988
DescriptionBfe1
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 331 a.a.     [Download]
>gi|375358282|ref|YP_005111054.1| putative transmembrane protein [Bacteroides fragilis 638R]
MAYRNEYKTQSEFNVILERGDDYEGFVVGLGYTWMSSKVILPVNQNGWSPISRNVSVDESFHTIVSERKY
DTSQYAYEKSLMQDPTKVSEKVRDLIVKNKGNNITEINLGQEKQYLPTDNSQISIVITDTGSRYEIVISA
TDNSNGKTYEAKYESLTDLVSAVRDSGSLPAVNKEGPNLEGLAGLGFGIAETAGNWAEKIMDNRGAYLPK
QMRFSPKTLPPIIRLPLGNYQVPAKGMSRVRGVGKALGWAGMVLTGYQVVRDVQNGRFAVAGTRIAVAGL
AYGVTFIPYVGWVLAIGIGVADYTWGDEFYDWIDNRASELEMWWDGVRLAL
-
Nucleotide Sequence: 996 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2346774-2345779 Bacteroides fragilis 638R, complete genome
ATGGCTTATAGAAATGAATATAAAACGCAAAGTGAATTTAATGTCATCTTGGAACGGGGGGATGACTATG
AAGGATTTGTAGTTGGCTTGGGATATACTTGGATGAGTAGCAAGGTAATTCTACCGGTAAATCAAAACGG
ATGGAGTCCAATATCTCGGAATGTTTCGGTGGACGAGAGTTTTCATACGATAGTCTCAGAAAGGAAATAC
GATACCTCCCAATATGCCTATGAAAAAAGTCTGATGCAAGATCCAACAAAAGTTTCCGAAAAGGTCCGTG
ACTTAATAGTTAAAAACAAAGGTAATAATATCACTGAGATAAATTTAGGCCAAGAAAAGCAATATTTGCC
CACGGATAATAGTCAGATAAGTATTGTAATTACTGACACTGGCAGTCGGTACGAAATTGTGATTAGTGCC
ACGGATAACTCAAATGGAAAGACTTATGAGGCAAAGTATGAGAGTTTGACGGACTTGGTGTCAGCGGTAC
GCGATTCTGGTAGCCTGCCTGCTGTAAATAAGGAAGGACCCAATCTGGAAGGACTGGCAGGGTTAGGATT
CGGAATTGCTGAAACAGCCGGAAATTGGGCTGAGAAGATTATGGATAATCGAGGTGCGTACTTACCTAAG
CAGATGCGTTTCTCGCCCAAAACGCTTCCGCCGATTATAAGATTGCCTTTAGGGAACTATCAAGTCCCCG
CTAAAGGTATGAGTAGAGTGCGTGGAGTAGGTAAAGCTTTGGGATGGGCAGGAATGGTGCTTACTGGCTA
TCAAGTTGTGCGTGATGTGCAAAATGGTCGATTTGCCGTGGCAGGTACAAGAATTGCCGTAGCAGGTTTA
GCTTATGGCGTTACTTTTATTCCCTATGTCGGTTGGGTCTTAGCTATCGGTATCGGAGTGGCTGATTATA
CTTGGGGTGACGAGTTCTATGACTGGATAGACAATAGAGCTTCTGAATTGGAAATGTGGTGGGACGGTGT
AAGATTAGCATTATGA

Reference
(1) Chatzidaki-Livanis M, Geva-Zatorsky N, Comstock LE (2016). Bacteroides fragilis type VI secretion systems use novel effector and immunity proteins to antagonize human gut Bacteroidales species. Proc Natl Acad Sci U S A. 113(13):3627-32. [PudMed:26951680] experimental
 
experimental experimental literature