SecReT6
Effector Protein ID: 377808420
-
SecReT6 ID518
T6SS typeA2
Gene symbol-
Locus tagBYI23_C010280
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]1206688..1207173 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDG8MHV7
KEGG IDbyi:BYI23_C010280
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.10E-37, Aligned region: 6..147
Protein Sequence: 161 a.a.     [Download]
>gi|377808420|ref|YP_004979612.1| hypothetical protein BYI23_C010280 [Burkholderia sp. YI23]
MAIPAYLWLKDDGGADIKGSVTVQGREGSVEIVEFDHGVHIPTDGNTGKLTGTRVHAPITLTKETDSSTP
YLYKAVTSGQTLKSVEIKWYKIDDAGKEKEYFNTKLDNVKVVAVRPKMLDIKNPAYEKHNHLEEVELRYE
QITWSYKDGNIIHKDTWNERA
-
Nucleotide Sequence: 486 bp     [Download]
>gi|377807392|ref|NC_016590.1|:1206688-1207173 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGGCAATTCCCGCATATTTGTGGCTGAAGGATGACGGCGGCGCCGACATCAAGGGTTCCGTCACGGTGC
AAGGTCGCGAAGGCAGCGTCGAAATCGTCGAGTTCGATCACGGCGTGCACATTCCGACCGATGGCAACAC
CGGCAAGCTGACCGGCACGCGCGTCCACGCACCGATCACGCTGACGAAGGAAACCGACTCATCGACGCCG
TACCTGTACAAGGCGGTGACGAGCGGCCAGACGTTGAAGTCGGTCGAGATCAAGTGGTACAAGATCGACG
ACGCGGGCAAGGAGAAGGAGTACTTCAACACGAAGCTCGACAACGTCAAGGTCGTCGCAGTGCGTCCGAA
GATGCTCGACATCAAGAATCCGGCCTACGAGAAGCACAACCACCTGGAAGAAGTCGAACTGCGCTACGAA
CAGATCACCTGGTCGTACAAGGACGGCAACATCATCCACAAGGACACGTGGAACGAGCGCGCGTAA