SecReT6
Effector Protein ID: 378451100
-
SecReT6 ID551
T6SS typeA3
Gene symbol-
Locus tagSTM14_2924
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. 14028S
Repliconchromosome [GenBank: NC_016856] [Browse all T6SS(s) in this replicon]
Location [Strand]2538467..2538835 [+]
Productputative cytoplasmic protein
Effector typeProtein
Homologous effectorSTY2606
DescriptionTae3_TY
UniProt IDD0ZQN3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NLPC_P60 [PF00877], Evalue: 9.10E-05, Aligned region: 23..95
CHAP [PF05257], Evalue: 0.00011, Aligned region: 17..88
Protein Sequence: 122 a.a.     [Download]
>gi|378451100|ref|YP_005238459.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
MSWDKRMAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHAKDYGPMLRSAGFTAIGTYEMPREGD
VIIIQPYAGGNPSGHMAIYDGTEWYSDFKQRDMWAGPGYRAARPSYTIYRKN
-
Nucleotide Sequence: 369 bp     [Download]
>gi|378448274|ref|NC_016856.1|:2538467-2538835 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S chromosome, complete genome
ATGAGTTGGGATAAAAGAATGGCGGTTAATTATGCCAAAACGCATGCAGGTTCTCATTCTCAAGGCCGGT
GTGCGGAATTTACCCGAAAGGCAATTCAGGCGGGCGGTATCACGCTGGGGCATACATATCATGCGAAAGA
TTATGGCCCAATGTTAAGAAGCGCCGGATTCACCGCTATTGGTACCTATGAAATGCCGCGCGAGGGTGAC
GTCATCATTATTCAACCTTACGCTGGCGGAAACCCGAGCGGTCACATGGCGATATACGATGGCACAGAGT
GGTATTCAGATTTTAAACAACGCGATATGTGGGCCGGCCCGGGCTACCGGGCAGCCAGGCCCTCATATAC
CATCTACAGGAAGAATTAA