SecReT6
Effector Protein ID: 378700285
-
SecReT6 ID535
T6SS typeA3
Gene symbol-
Locus tagSL1344_2344
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Repliconchromosome [GenBank: NC_016810] [Browse all T6SS(s) in this replicon]
Location [Strand]2484631..2484999 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTY2606
DescriptionTae3_TY
UniProt IDE1WCL5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NLPC_P60 [PF00877], Evalue: 9.10E-05, Aligned region: 23..95
CHAP [PF05257], Evalue: 0.00011, Aligned region: 17..88
Protein Sequence: 122 a.a.     [Download]
>gi|378700285|ref|YP_005182242.1| hypothetical protein SL1344_2344 [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344]
MSWDKRMAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHAKDYGPMLRSAGFTAIGTYEMPREGD
VIIIQPYAGGNPSGHMAIYDGTEWYSDFKQRDMWAGPGYRAARPSYTIYRKN
-
Nucleotide Sequence: 369 bp     [Download]
>gi|378697983|ref|NC_016810.1|:2484631-2484999 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344, complete genome
ATGAGTTGGGATAAAAGAATGGCGGTTAATTATGCCAAAACGCATGCAGGTTCTCATTCTCAAGGCCGGT
GTGCGGAATTTACCCGAAAGGCAATTCAGGCGGGCGGTATCACGCTGGGGCATACATATCATGCGAAAGA
TTATGGCCCAATGTTAAGAAGCGCCGGATTCACCGCTATTGGTACCTATGAAATGCCGCGCGAGGGTGAC
GTCATCATTATTCAACCTTACGCTGGCGGAAACCCGAGCGGTCACATGGCGATATACGATGGCACAGAGT
GGTATTCAGATTTTAAACAACGCGATATGTGGGCCGGCCCGGGCTACCGGGCAGCCAGGCCCTCATATAC
CATCTACAGGAAGAATTAA