SecReT6
Effector Protein ID: 378766607
hcp1
SecReT6 ID536
T6SS typeA3
Gene symbolhcp1
Locus tagPANA5342_1639
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1736924..1737406 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDG9AQJ1
KEGG IDplf:PANA5342_1639
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.60E-35, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|378766607|ref|YP_005195069.1| type VI secretion system effector [Pantoea ananatis LMG 5342]
MAIDIYLKVEGTAGESQDSNHKGWTDVLSFNWGASQPGNMAVGGGGGSGKVNFNDLRVKALIDKSTAAIL
KYCSSGKHVSKVELSVCKAGGNQIEYTKIVLEDVLVTATDFNGVGQGDTIVVDYAFQASKVSTSYWEQSA
SGTKGAESKAGWDIKQNKES
-
Nucleotide Sequence: 483 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1736924-1737406 Pantoea ananatis LMG 5342, complete genome
ATGGCGATTGATATTTATTTGAAAGTTGAAGGGACTGCTGGAGAATCACAGGACAGCAATCATAAAGGAT
GGACCGACGTGCTCTCATTTAACTGGGGGGCTTCGCAACCCGGTAATATGGCGGTAGGTGGCGGTGGCGG
CTCAGGAAAAGTGAATTTCAACGATCTGCGTGTTAAAGCGTTAATCGACAAATCCACTGCTGCCATTCTT
AAATACTGCTCCAGCGGAAAGCATGTTTCAAAGGTAGAACTGTCGGTTTGCAAAGCCGGTGGCAACCAAA
TTGAGTACACGAAGATTGTGCTGGAAGATGTACTGGTTACGGCAACGGATTTTAACGGAGTAGGGCAAGG
TGACACCATTGTGGTGGACTACGCCTTTCAGGCATCCAAAGTGTCTACCAGCTACTGGGAACAAAGTGCC
AGCGGTACCAAAGGGGCGGAAAGCAAAGCTGGTTGGGATATTAAACAAAATAAAGAGAGCTGA