SecReT6
Effector Protein ID: 378766608
hcp3
SecReT6 ID536
T6SS typeA3
Gene symbolhcp3
Locus tagPANA5342_1640
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1737437..1737919 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorSMA3456
DescriptionHcp protein
UniProt IDG9AQJ2
KEGG IDplf:PANA5342_1640
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.80E-39, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|378766608|ref|YP_005195070.1| type VI secretion system effector [Pantoea ananatis LMG 5342]
MAIDIFLKIDGIEGESQNANHKKWIDVLSFNWGAQQPGNMSVGGGGGAGKVNYRDLSVEALIDKATPALV
KYCASGKHLPKIQLSVCKAGGQEVEYTRITLEDVLVTQTDFTGIGHASTLGMQYSFQASKVALEYWEQAS
QGTKAASVQMGWDIKQNKES
-
Nucleotide Sequence: 483 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1737437-1737919 Pantoea ananatis LMG 5342, complete genome
ATGGCTATTGATATCTTTTTGAAAATAGATGGAATTGAAGGTGAGTCGCAAAATGCAAACCATAAAAAAT
GGATAGATGTTCTGTCATTTAACTGGGGCGCGCAGCAACCAGGTAATATGTCCGTTGGCGGTGGTGGCGG
TGCGGGAAAAGTGAATTATCGCGATTTAAGCGTTGAGGCATTGATCGATAAGGCCACACCGGCGTTAGTG
AAATATTGTGCAAGTGGTAAACATCTGCCAAAAATTCAGCTGTCTGTTTGCAAGGCAGGCGGGCAGGAAG
TGGAATATACTCGCATCACGCTTGAAGATGTGCTGGTTACGCAGACTGACTTTACCGGCATTGGTCACGC
GTCCACGCTGGGTATGCAGTATTCCTTTCAAGCCAGCAAGGTTGCGCTGGAATACTGGGAACAGGCTTCT
CAGGGAACGAAAGCCGCTTCTGTGCAGATGGGTTGGGATATCAAGCAAAATAAAGAAAGCTAA