SecReT6
Effector Protein ID: 378766721
rhsD1
SecReT6 ID536
T6SS typeA3
Gene symbolrhsD1
Locus tagPANA5342_1754
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1864699..1869153 [+]
ProductRHS Repeat family protein
Effector typeProtein
Homologous effectorECL_01567
DescriptionrhsA
UniProt IDG9AQV6
KEGG IDplf:PANA5342_1754
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 393..410
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 431..444
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 482..509
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 555..576
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 590..626
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 654..690
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 697..732
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 727..745
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 759..796
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 780..816
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 801..857
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 868..896
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 914..933
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 920..955
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 983..1010
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 1050..1063
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 1055..1087
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 1093..1117
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 1106..1135
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 1147..1163
RHS_repeat [PF05593], Evalue: 1.80E-55, Aligned region: 1291..1322
DUF4237 [PF14021], Evalue: 1.30E-27, Aligned region: 349..364
DUF4237 [PF14021], Evalue: 1.30E-27, Aligned region: 1389..1484
PAAR_motif [PF05488], Evalue: 6.40E-15, Aligned region: 4..14
PAAR_motif [PF05488], Evalue: 6.40E-15, Aligned region: 92..131
PAAR_motif [PF05488], Evalue: 6.40E-15, Aligned region: 176..218
RHS [PF03527], Evalue: 6.40E-12, Aligned region: 736..752
RHS [PF03527], Evalue: 6.40E-12, Aligned region: 762..774
RHS [PF03527], Evalue: 6.40E-12, Aligned region: 932..946
RHS [PF03527], Evalue: 6.40E-12, Aligned region: 988..1008
RHS [PF03527], Evalue: 6.40E-12, Aligned region: 1116..1127
RHS [PF03527], Evalue: 6.40E-12, Aligned region: 1222..1261
DUF4150 [PF13665], Evalue: 0.00094, Aligned region: 107..125
DUF4150 [PF13665], Evalue: 0.00094, Aligned region: 170..215
Protein Sequence: 1484 a.a.     [Download]
>gi|378766721|ref|YP_005195184.1| RHS Repeat family protein [Pantoea ananatis LMG 5342]
MDNRAARVGDEIIHSSIFADITSIVAEGAAYAVIGAAVGVAATAAAPLLGAGMAAAGVAAIGSSCLLSGI
IGGVLANAAGISDDITKAADGLGDMIFPPSPAGVIASGSENVHVNGLLAARAAGMLTPGDTPPPEPQSPK
SFADYGGMLLSAVGQFGSAMWQPTVASADAGTSPLEQDKVACEKHSAPQYLAQGSKSVFINGQPAVRAKD
KTTCDATVSDDVSPNVIIGGETVTVREIKSGKVPGLAVMMIGLSLIRGRPSQILKNMPCALASAVGGMMA
DMAINAAFSSLFPVHASTGVKVLNDDAERDFSLPGRFPLSFQRSYNSLTQRSGLFGLGWATVFDSYITLD
GNQATWFDDNGRELSFAVPGEKEVLYSISEGLMVRRNELGDIAIADDDGAVWRLYRRTAADPQVLRLASL
SDEYGNALEMGWDEQARLVRIHDAPLAIDVTLHYDDKQHAQRPTSASHFDGEQHWPLTLWTYNEQGQLAS
VTDAAGVVSRRFRYNDDGLMIWHQLPGGLESEYRWQKLDHWRVVENRTNTGDGCHMHYDLDAGITRVSTY
DGQQREHHWNAAGLITCFIDERGETWRYEWDENELLTRRIDPLGNAVSFTYDDLGNRVEEKDADGGVQAV
QWLSHRSLPTVVAGADGATTKYYYDPHHGLERVVDALGQSTFYKRDEFGLVVEEIDAAGNSYRREFNDAG
QVIRETDCSGLTTRYRYHPLGWLSCVTAPDGEETRYHYDAAGRPVLLERAEGWEERLRWSDNGLPLAHES
ADGKRSEFRYDNVGRLIANRNAQGETVQRSWDSRGRLTALQNENGEQYQFEWGADSLLLAQVGLDGVATR
YDYDAAGRTVSRTFAAGHPQAITHRYHWSRAGQLLARTTPEGQTRYHYSGGGQLSKVSQHLPLSDTEWSQ
QAEQEIAFTYDALGRIVGEQGEQGALAWDYDALGNCTALTLPDGRNLKQLYYGSGHLLSIALDNLPVTEF
TRDTLHRELSRTQGGLTTRSEYDRLGRLRRRDVFKGEAQRPAPRVWSRRRDFDYGNNLIREERDDNPFSQ
TLWHYDNAGRLLSQEGAQPGNEQWRWDGAGNPLDRHAASHIMHNRVTELNGIRWQYDIHGRTTEKDDGQT
RWRYRYDGEHRLTDVISEPRDRNKPRTKVSFRYDPLGRRISKTRQQLLQGRPSGKAITTRFVWEGYRLLQ
EIHDDTPLTYVYSDSQSYEPLARIDGVESPEIFWFHCAANGTPELLTDVEGQKTWEGVNSPWGKLLRESN
QRIPVVEQNLRMQGQYLDRETGLHYNLFRYYDPDSGRFTQQDPIGLAGGINLYQYAPNALGWVDPLGLSR
CKNEWNEFQKKSNNNQFTSRKQASKAYALWKKQDWAALEQFMGEGAWPPNRGFVKATRTTLQPGTLVDRY
GGWIDEKGFHDTGTFISPVGSSFEGRALQSSTLDKPYSIYEVLKPLPVDTGPAIPWFGQPGYGTQHETFL
KIDKLIEKGYLRKV
-
Nucleotide Sequence: 4455 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1864699-1869153 Pantoea ananatis LMG 5342, complete genome
ATGGATAACCGTGCGGCCCGCGTGGGCGATGAGATCATTCATTCCAGCATTTTCGCTGATATCACCAGTA
TTGTCGCTGAGGGCGCAGCCTACGCCGTGATCGGTGCGGCGGTCGGTGTGGCGGCAACAGCAGCAGCACC
ATTGCTGGGTGCAGGAATGGCTGCGGCAGGCGTGGCAGCCATTGGTTCCAGCTGTCTGCTCAGCGGCATT
ATTGGCGGTGTATTAGCGAACGCTGCGGGCATTTCGGATGACATCACTAAAGCGGCCGATGGGCTGGGAG
ACATGATATTCCCGCCTTCTCCAGCCGGTGTGATCGCCAGCGGATCAGAGAATGTTCACGTTAATGGTCT
TTTAGCTGCACGCGCGGCCGGGATGCTTACGCCCGGAGATACGCCGCCACCGGAACCGCAATCGCCCAAG
AGTTTCGCAGACTATGGCGGCATGCTGCTCTCTGCGGTGGGTCAGTTTGGCAGTGCAATGTGGCAACCCA
CGGTGGCTTCCGCCGACGCTGGCACCTCTCCGCTTGAACAGGACAAAGTGGCCTGTGAAAAGCACAGCGC
ACCGCAATATCTGGCGCAGGGATCGAAAAGCGTCTTTATCAATGGCCAGCCTGCGGTGCGGGCAAAGGAT
AAAACCACCTGTGATGCCACCGTGAGTGACGATGTTTCCCCCAATGTCATCATTGGTGGTGAAACCGTCA
CAGTAAGAGAGATTAAAAGTGGCAAGGTGCCAGGTCTGGCCGTGATGATGATCGGCCTTTCCCTGATTCG
TGGTCGGCCCAGCCAGATCCTGAAAAACATGCCCTGTGCGCTGGCGAGCGCTGTAGGCGGGATGATGGCG
GATATGGCGATTAACGCCGCCTTCTCGTCGCTGTTTCCGGTTCATGCCTCCACGGGCGTCAAAGTGCTTA
ACGATGATGCCGAGCGCGATTTCTCCCTTCCTGGTCGCTTCCCGCTCAGTTTCCAGCGTAGCTATAACAG
CCTGACCCAGCGCAGCGGATTATTTGGTCTGGGCTGGGCGACGGTGTTTGACAGCTATATAACGCTGGAT
GGCAATCAGGCGACCTGGTTTGATGACAACGGGCGCGAGTTGAGCTTTGCGGTTCCCGGTGAAAAAGAGG
TGCTCTACAGCATCAGCGAAGGGCTGATGGTAAGGCGCAACGAACTGGGTGATATCGCCATTGCCGACGA
CGACGGTGCGGTATGGCGTCTGTACAGACGTACGGCCGCAGATCCGCAAGTGCTGCGGCTGGCTTCACTG
AGCGACGAATACGGCAATGCGCTGGAGATGGGCTGGGACGAACAGGCTCGCCTGGTGCGCATTCATGACG
CGCCGCTGGCCATTGACGTTACCCTGCATTACGACGACAAACAGCATGCACAGCGCCCGACCTCGGCCAG
TCACTTTGATGGTGAGCAGCACTGGCCATTAACGCTCTGGACTTACAATGAACAGGGCCAGCTTGCCAGC
GTCACCGATGCCGCAGGCGTTGTCTCGCGGCGCTTCCGTTACAACGATGACGGGTTAATGATCTGGCATC
AACTGCCGGGCGGGCTGGAAAGCGAATATCGCTGGCAGAAGCTGGATCACTGGCGCGTCGTTGAAAACCG
CACCAATACCGGTGACGGCTGCCATATGCATTATGATCTTGATGCTGGCATCACGCGCGTATCGACCTAT
GACGGTCAGCAGCGAGAACATCACTGGAATGCTGCAGGGCTCATCACCTGCTTTATTGATGAGCGGGGCG
AGACCTGGCGCTATGAGTGGGATGAAAACGAACTCCTGACGCGCCGTATCGATCCGCTGGGTAATGCGGT
GAGCTTCACCTATGACGATCTCGGCAACCGTGTAGAAGAGAAAGATGCGGACGGCGGTGTACAGGCGGTG
CAATGGCTGTCACACCGTTCTCTGCCCACGGTCGTTGCCGGGGCTGACGGTGCCACCACGAAATACTATT
ACGATCCCCATCATGGCCTTGAGCGCGTGGTTGATGCGCTCGGGCAGAGTACCTTCTATAAGCGGGATGA
GTTTGGGCTGGTTGTCGAAGAGATTGACGCGGCAGGCAACAGCTACCGTCGTGAATTCAATGATGCCGGC
CAGGTTATCCGCGAAACAGACTGTTCAGGGCTGACGACGCGCTACCGCTATCATCCCCTTGGCTGGCTCA
GCTGTGTGACTGCGCCGGATGGTGAAGAAACCCGGTATCACTATGATGCTGCGGGCCGTCCTGTTCTGCT
GGAGCGGGCAGAGGGCTGGGAAGAGCGATTGCGCTGGAGCGACAACGGCCTGCCACTGGCCCACGAGTCA
GCGGATGGTAAACGTAGTGAATTCCGCTACGACAACGTCGGGCGCTTAATCGCCAACCGTAATGCCCAGG
GCGAGACGGTTCAGCGCAGCTGGGACAGCCGTGGTCGGTTGACGGCGCTGCAAAACGAGAACGGCGAGCA
GTATCAGTTCGAGTGGGGCGCAGATTCCCTGTTGCTGGCCCAGGTTGGGCTGGATGGTGTTGCTACACGA
TATGACTATGATGCGGCGGGCCGCACGGTATCACGCACCTTTGCCGCCGGGCATCCTCAGGCGATTACCC
ATCGCTATCACTGGAGCCGTGCGGGGCAACTGCTGGCACGGACCACGCCGGAAGGCCAGACGCGCTATCA
CTACAGCGGTGGTGGGCAGTTAAGTAAAGTGTCGCAGCATCTGCCGCTGTCTGACACCGAGTGGAGCCAG
CAGGCCGAGCAGGAGATTGCGTTTACCTATGATGCGCTGGGCCGCATCGTAGGTGAGCAGGGTGAACAGG
GCGCGCTGGCCTGGGATTACGACGCGCTGGGTAACTGCACGGCCTTAACCCTGCCGGATGGTCGCAATCT
GAAGCAGCTTTACTACGGCAGCGGCCATTTACTGAGCATCGCGCTGGACAACCTGCCGGTCACCGAGTTT
ACCCGTGACACATTGCATCGGGAACTCAGCCGCACGCAGGGCGGCCTGACCACGCGCAGTGAGTATGACC
GGTTGGGCAGGCTGCGCCGCCGTGACGTTTTCAAAGGTGAAGCACAGCGTCCTGCGCCGCGCGTCTGGTC
CCGTCGGCGGGACTTCGATTACGGCAACAACCTGATTCGTGAAGAGCGCGACGATAACCCGTTCAGCCAG
ACATTATGGCACTACGATAACGCCGGTCGGCTGCTGTCTCAGGAAGGCGCGCAGCCGGGTAATGAGCAGT
GGCGCTGGGATGGCGCAGGCAACCCGCTGGATCGCCATGCCGCTTCCCATATCATGCATAACCGTGTCAC
TGAACTGAACGGTATCCGCTGGCAGTACGACATTCATGGCCGCACCACCGAAAAGGATGACGGCCAGACC
CGCTGGCGCTACCGTTACGATGGTGAGCACCGCCTGACGGATGTCATCAGCGAACCGCGGGACCGCAATA
AGCCACGTACTAAGGTGAGCTTCCGCTACGATCCGCTGGGTCGACGCATCAGTAAAACCCGCCAGCAACT
GTTACAGGGCAGGCCGTCTGGCAAGGCCATCACAACGCGCTTTGTCTGGGAAGGCTATCGTCTGCTGCAG
GAGATCCACGACGATACTCCACTTACCTATGTGTACAGCGACAGCCAGAGCTATGAGCCGCTGGCCCGTA
TTGATGGCGTGGAAAGCCCGGAGATATTCTGGTTTCACTGCGCGGCAAACGGGACGCCGGAACTGCTGAC
CGACGTTGAAGGCCAGAAAACCTGGGAAGGTGTGAACAGCCCATGGGGCAAACTACTGCGCGAGTCTAAC
CAGCGAATTCCGGTGGTGGAGCAGAACCTGCGTATGCAGGGCCAGTACCTGGATCGTGAAACCGGGCTGC
ACTACAATCTGTTTCGTTATTATGACCCGGACAGCGGACGGTTTACCCAGCAGGACCCGATAGGGCTGGC
GGGCGGTATTAACCTTTACCAGTATGCGCCGAATGCGCTGGGCTGGGTGGATCCGTTGGGGTTGAGTAGG
TGTAAAAACGAATGGAATGAGTTTCAGAAAAAATCGAACAATAATCAATTTACTTCAAGGAAACAAGCAT
CCAAAGCATATGCTTTATGGAAAAAACAAGACTGGGCAGCGTTAGAACAATTTATGGGTGAAGGTGCTTG
GCCACCTAATCGCGGTTTCGTAAAAGCAACAAGAACAACTCTTCAACCCGGCACTTTAGTTGATCGATAT
GGTGGTTGGATCGATGAAAAAGGATTCCATGATACTGGTACTTTTATTTCTCCAGTAGGTTCATCATTTG
AGGGCAGGGCTTTACAATCGAGTACACTGGATAAACCTTATTCAATTTATGAGGTATTGAAGCCATTGCC
GGTTGATACTGGACCAGCTATACCATGGTTTGGACAGCCAGGCTACGGAACGCAACATGAAACCTTTTTG
AAAATTGATAAACTAATCGAGAAAGGCTATTTGAGGAAAGTATGA