SecReT6
Effector Protein ID: 378768189
rhsD7
SecReT6 ID536
T6SS typeA3
Gene symbolrhsD7
Locus tagPANA5342_3230
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]3373950..3378110 [+]
ProductRhs family protein
Effector typeProtein
Homologous effectorECL_03140
DescriptionrhsB
UniProt IDG9AX50
KEGG IDplf:PANA5342_3230
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 367..394
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 421..442
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 509..525
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 549..569
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 597..629
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 636..672
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 657..693
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 678..706
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 699..732
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 720..755
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 741..777
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 808..824
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 864..897
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 927..953
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 982..1006
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 998..1028
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 1074..1105
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 1134..1144
RHS_repeat [PF05593], Evalue: 5.20E-42, Aligned region: 1173..1196
PAAR_motif [PF05488], Evalue: 2.10E-16, Aligned region: 4..14
PAAR_motif [PF05488], Evalue: 2.10E-16, Aligned region: 83..155
RHS [PF03527], Evalue: 3.80E-13, Aligned region: 723..752
RHS [PF03527], Evalue: 3.80E-13, Aligned region: 760..770
RHS [PF03527], Evalue: 3.80E-13, Aligned region: 1053..1064
RHS [PF03527], Evalue: 3.80E-13, Aligned region: 1095..1102
RHS [PF03527], Evalue: 3.80E-13, Aligned region: 1165..1202
Tox-HNH-EHHH [PF15657], Evalue: 1.50E-09, Aligned region: 1308..1370
DUF4595 [PF15283], Evalue: 1.40E-05, Aligned region: 375..402
DUF4595 [PF15283], Evalue: 1.40E-05, Aligned region: 419..446
DUF4595 [PF15283], Evalue: 1.40E-05, Aligned region: 605..680
DUF4595 [PF15283], Evalue: 1.40E-05, Aligned region: 856..883
DUF4595 [PF15283], Evalue: 1.40E-05, Aligned region: 996..1089
DUF4150 [PF13665], Evalue: 0.0015, Aligned region: 83..111
DUF4150 [PF13665], Evalue: 0.0015, Aligned region: 120..155
Protein Sequence: 1386 a.a.     [Download]
>gi|378768189|ref|YP_005196660.1| Rhs family protein [Pantoea ananatis LMG 5342]
MFEAARLGDDIGHSHALAGMIAGTIVGGLIAAAGGIAAGALMIAGIGASCLGVGVLLVGLSIGVGYLTGE
LATAARDGIADAGAASMTPKGKITTGSPNVFINSKPAAMATNSIVACKDDGPQQMAEGSSRVYINGLPAS
RIDDRTTCDAKVMTGSDNVYIGGEPEQTLPVQPEVPEWVYKASDLTLLFAGLAGGVGGAAGKVGALGKLL
SKIPGINKIARVACRAGALMTGVAAAGILARPVDIVSGQKFLSGDDELDFVLPSRLPLRWQRYWRSGNPG
DSVLGRGWNLFWETRLERYQDGLVWRASSGDYVSFPLVPKGQRTYCEAEKRWLEHHRDDSWSLYDISGER
WHFMPLRNDAPSLPLCLTEPCGNEIQFDWNPDHTLAALTDSAGQRVTCRYANDRLAGAWLDDDICLVSYA
YDDIGQLVTVTGRGGSVRRRFQWCDGLMVAHEDMNGLLSEYRWQEIDGLPRVVAFRHSGGEQLDFEYDFD
NGIRRARRDDGVEAHWLIDDDDHVARFTDFDGRQTMLVYRAGELCDVIMPGGAMRCSNWDRYGRMTQEID
PVGRRTTYHWFRMTDRVIRTDYPDLSATQAAYDLNVRLLTETDALNNVTTYHYPDDTELLPDSITDATGG
VVKLEWNRQGLLTQRTDCSGSVTTFSYDRFGQLVRSVDAEGHVTQREWNDKGQLCAIIHPDGSRETLHWN
PQGQLSAWRDPLETEVRWTYNALGLPVSLTDRIGRTRRWHYDARGNLLRLENGNGGDYRFTCDPLGRPLS
EIRPDKTSRNMEWNARGFLIGLQENGQPANDGGIARRWQRFSYDDSGLITQRTTQHAEYHYRRHRSGQLA
SLVRTPTSDGMALGIEEDEIAFTYDVAGQLLTEAGINGKLDYEWDALGNLTHLTLPGEQQLAWLHYGSGH
VSAIRFNQQLVSEFTRDRLHREIRRSQGAREQARQYDSLGRRTMQRSELHSEVVLPEKAILERAFRYSAR
SELESVSDTLRGDIIYGYDDEGRLLKHYEARQGHSTSHFTYDNADNLAANDDALHALPVTDNRVHHWQNL
FMKYDDWGNLVSRRSGLHEQHFTYDAENRLISAKGNGPDGGFTAHYHYDALGRRTCKVVSTQHDRKEVRF
LWQGYRLLQEQQDNGQCQTYVYDPNEAWSPLARIDHMAAGERGDVLWFNTDLNGAPLEVTDERGDIRWSG
QYGSFGEVRRQTEGFTRLVKQSALPHQPLRYAGQYADSETGLHYNLFRYYDPQVGRFTVQDPIGLEGGWN
LYQYAPNPLSWVDPLGLSNLSTTFKAMFREAKRKLGIPKNTNTPQAVKVFDSKYENRTVWEFNHNGDKKY
IIMHEDDKFGRGPHLHTADDLHGNPLDKNVRYNQHPGHIPENKIGITDMRGKKRCP
-
Nucleotide Sequence: 4161 bp     [Download]
>gi|378764971|ref|NC_016816.1|:3373950-3378110 Pantoea ananatis LMG 5342, complete genome
ATGTTTGAAGCTGCACGCCTCGGCGATGATATCGGTCACTCTCATGCCCTGGCGGGCATGATTGCAGGCA
CTATCGTCGGTGGACTGATCGCTGCGGCGGGCGGTATTGCTGCGGGTGCATTGATGATTGCCGGGATAGG
CGCCTCCTGCCTTGGCGTGGGCGTATTGCTGGTTGGACTCAGTATCGGCGTGGGTTACCTTACTGGCGAA
CTGGCCACCGCCGCGCGAGACGGAATAGCGGATGCTGGGGCGGCCAGCATGACCCCAAAGGGCAAGATTA
CCACCGGTTCGCCCAACGTCTTTATTAACAGTAAACCCGCCGCCATGGCCACCAACAGCATAGTGGCATG
CAAGGACGATGGTCCGCAGCAGATGGCGGAAGGCTCCTCCCGGGTGTACATCAACGGCCTGCCTGCATCA
CGCATTGACGATCGCACCACCTGCGATGCCAAAGTGATGACGGGCTCTGACAACGTCTATATCGGCGGCG
AGCCTGAACAAACGCTGCCTGTCCAACCTGAAGTGCCCGAATGGGTTTATAAAGCCTCCGATCTTACCCT
GCTGTTTGCCGGGCTGGCCGGTGGCGTGGGCGGTGCGGCTGGCAAGGTCGGCGCGCTGGGTAAATTACTG
AGCAAGATTCCCGGTATCAATAAAATCGCCCGGGTGGCCTGCCGTGCTGGTGCCTTGATGACCGGTGTGG
CGGCCGCAGGTATTCTTGCCCGTCCCGTTGATATCGTAAGCGGCCAGAAGTTTCTTAGCGGCGATGATGA
ACTGGATTTTGTGCTGCCCTCCAGGCTGCCGCTACGCTGGCAGCGCTACTGGCGCAGCGGTAATCCCGGC
GACAGCGTATTAGGACGTGGCTGGAACCTGTTCTGGGAAACACGGCTGGAACGCTACCAGGATGGGCTGG
TCTGGCGTGCGTCCTCCGGCGATTACGTCTCTTTTCCTCTGGTGCCCAAAGGCCAGCGTACCTACTGCGA
AGCGGAGAAACGCTGGCTGGAACATCATCGGGACGACAGTTGGTCATTGTATGACATCAGCGGTGAGCGC
TGGCATTTTATGCCCCTGCGCAATGACGCCCCTTCTCTGCCCCTCTGCCTGACCGAGCCCTGCGGCAATG
AGATTCAGTTCGACTGGAACCCCGATCACACATTGGCCGCGCTGACAGACAGCGCCGGTCAGCGCGTAAC
CTGCCGCTATGCGAATGACAGGCTCGCAGGTGCCTGGCTGGATGACGATATTTGTCTGGTCAGTTACGCG
TATGATGATATCGGCCAACTCGTTACGGTAACGGGCCGGGGCGGTAGCGTGCGCCGACGCTTCCAGTGGT
GCGATGGCCTGATGGTCGCCCATGAAGATATGAATGGCCTGCTAAGTGAGTATCGCTGGCAGGAGATCGA
TGGCCTCCCAAGAGTGGTGGCCTTCCGTCACAGCGGCGGCGAGCAGCTGGATTTTGAGTACGATTTTGAC
AACGGTATCCGACGCGCGCGACGTGATGACGGCGTTGAAGCTCACTGGCTCATTGACGATGACGATCATG
TCGCCCGCTTCACCGACTTCGACGGCCGCCAGACCATGCTGGTTTACCGCGCAGGCGAGTTGTGCGATGT
GATTATGCCCGGCGGCGCCATGCGCTGCAGCAACTGGGACCGCTATGGTCGCATGACGCAGGAGATCGAT
CCGGTCGGACGTCGAACCACTTATCACTGGTTCCGCATGACTGACCGTGTGATCCGTACGGACTATCCCG
ATCTGAGCGCGACTCAGGCGGCTTACGATCTTAATGTTCGCCTGCTGACTGAAACCGATGCGCTCAATAA
CGTCACCACCTATCACTACCCTGATGACACAGAACTGCTGCCAGACAGCATCACCGATGCAACGGGCGGC
GTGGTGAAGCTGGAATGGAACCGACAAGGGCTGCTGACGCAGCGCACCGACTGCTCTGGCAGCGTAACGA
CGTTTAGCTACGACCGATTTGGCCAGCTTGTTCGCAGCGTGGATGCTGAAGGTCATGTCACCCAGCGCGA
GTGGAATGACAAGGGACAACTCTGCGCCATCATCCATCCAGACGGTAGCCGGGAAACCCTGCACTGGAAC
CCCCAGGGGCAGCTCAGTGCGTGGCGCGATCCGCTGGAAACCGAAGTCCGCTGGACCTATAACGCACTCG
GATTACCGGTAAGCCTGACGGACCGCATTGGTCGCACGCGTCGCTGGCATTACGATGCCCGCGGTAATCT
GCTGCGGCTGGAAAACGGCAACGGCGGTGACTATCGCTTTACCTGCGATCCGCTCGGCCGTCCATTGAGT
GAGATCCGGCCCGATAAGACCTCACGCAATATGGAATGGAATGCTCGTGGCTTTCTCATTGGTTTACAGG
AAAATGGCCAGCCCGCTAATGACGGTGGCATAGCTCGACGCTGGCAGCGCTTTAGCTACGACGACAGCGG
CTTGATTACCCAGCGCACAACGCAGCATGCTGAATACCACTACCGGCGTCATCGTAGCGGTCAACTTGCC
AGCCTGGTTCGCACGCCGACCAGCGACGGAATGGCGCTTGGTATCGAAGAAGATGAAATCGCCTTTACCT
ATGACGTCGCAGGTCAGCTGTTAACAGAAGCCGGTATAAACGGGAAACTGGATTACGAATGGGATGCGCT
GGGCAACCTCACCCATCTGACCCTGCCGGGTGAACAGCAACTTGCCTGGTTGCACTATGGCTCTGGCCAT
GTCAGCGCGATTCGCTTTAATCAGCAACTGGTCAGTGAATTTACCCGCGACCGCCTGCACCGGGAAATTC
GTCGCAGTCAGGGCGCGCGTGAGCAGGCGCGTCAGTACGACAGCCTTGGCAGGCGTACGATGCAGCGCAG
TGAATTGCATAGCGAGGTGGTGCTACCGGAAAAAGCCATTCTGGAACGCGCTTTCCGCTATTCGGCGCGC
AGTGAACTGGAGTCTGTCAGTGATACGCTGCGCGGCGACATTATCTATGGTTACGATGATGAAGGCCGCC
TGCTGAAGCACTACGAAGCCAGACAGGGCCACAGCACCTCGCATTTTACTTACGATAATGCGGACAACCT
GGCCGCCAACGACGATGCACTGCACGCGTTGCCGGTTACCGACAATCGAGTGCATCACTGGCAGAACCTG
TTTATGAAGTACGATGACTGGGGCAACCTGGTCAGTCGACGCAGCGGCCTGCATGAGCAGCATTTTACCT
ATGACGCCGAAAACCGGCTCATTAGCGCCAAAGGCAATGGCCCGGACGGCGGGTTTACCGCGCATTATCA
TTATGATGCGCTGGGCAGGCGCACCTGCAAAGTGGTCAGCACCCAGCACGATCGTAAAGAAGTCCGTTTT
CTGTGGCAGGGCTATCGCCTGTTACAGGAGCAACAGGATAATGGCCAGTGCCAGACCTATGTGTACGATC
CCAACGAGGCCTGGAGCCCGCTGGCGCGCATCGACCATATGGCAGCAGGCGAACGGGGCGATGTGTTGTG
GTTCAATACCGATCTCAACGGGGCACCGCTGGAGGTAACCGATGAACGCGGCGACATCCGCTGGAGCGGC
CAGTACGGCAGCTTTGGTGAAGTGCGTCGGCAGACAGAGGGCTTTACCCGTCTGGTGAAACAGTCTGCCC
TGCCCCATCAGCCGCTGCGCTATGCGGGCCAGTATGCGGACAGCGAAACCGGTCTGCATTACAATCTGTT
CCGCTATTACGACCCGCAGGTGGGACGGTTCACGGTTCAGGACCCGATAGGGCTGGAAGGCGGCTGGAAC
CTTTATCAGTATGCGCCGAACCCGCTGAGCTGGGTGGATCCGCTGGGGTTGAGTAATCTGTCCACAACTT
TCAAAGCTATGTTTAGGGAAGCTAAAAGGAAATTAGGTATACCTAAAAATACAAATACACCACAAGCTGT
AAAAGTTTTCGATTCTAAATATGAAAACAGAACAGTCTGGGAATTTAATCATAACGGTGATAAAAAATAT
ATCATCATGCATGAGGATGATAAATTTGGCAGGGGCCCTCATTTACACACTGCCGATGATTTGCATGGAA
ACCCATTAGATAAAAATGTCCGTTACAATCAACATCCAGGACATATCCCCGAAAATAAGATTGGAATTAC
AGATATGCGAGGAAAAAAAAGATGTCCTTGA