SecReT6
Effector Protein ID: 378953681
impD2
SecReT6 ID540
T6SS typeA3
Gene symbolimpD2
Locus tagPSF113_5800
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6684399..6684887 [+]
Productprotein ImpD
Effector typeProtein
Homologous effectorPA0085
DescriptionHcp protein
UniProt IDG8Q718
KEGG IDpfe:PSF113_5800
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-46, Aligned region: 6..137
Protein Sequence: 162 a.a.     [Download]
>gi|378953681|ref|YP_005211169.1| protein ImpD [Pseudomonas fluorescens F113]
MAVDIFIKIGDIKGESMDKAHKDEIDVLNWSWGMSQSGNMHVGSGGGAGKVNVQDLSLTKYVDKASPNLM
MHCASGKHIDKVKLTVRKAGGESQVEYMIINLEEVLVTSLSTGGSGGDDRLTENVTLNFAKVLVDYQPQK
ADGTKEGGPVKFGWNIRQNVKV
-
Nucleotide Sequence: 489 bp     [Download]
>gi|378947941|ref|NC_016830.1|:6684399-6684887 Pseudomonas fluorescens F113 chromosome, complete genome
ATGGCTGTTGATATTTTCATCAAGATCGGCGACATCAAGGGCGAGTCCATGGACAAGGCCCACAAGGACG
AGATCGATGTCCTGAACTGGAGCTGGGGCATGTCCCAGTCCGGCAACATGCACGTGGGCAGCGGCGGTGG
TGCGGGCAAGGTCAACGTCCAGGACCTGTCCCTGACCAAGTACGTCGACAAGGCGTCGCCAAATCTGATG
ATGCACTGCGCCAGCGGCAAGCACATCGACAAGGTCAAGCTGACCGTGCGCAAGGCCGGCGGTGAAAGCC
AGGTCGAGTACATGATCATCAACCTGGAAGAAGTGCTGGTTACGTCCCTGAGCACCGGCGGCTCGGGCGG
CGATGATCGCCTGACCGAAAACGTCACCCTGAACTTCGCCAAGGTGCTGGTGGACTACCAGCCACAGAAA
GCCGACGGCACCAAGGAAGGCGGTCCGGTCAAGTTCGGCTGGAACATCCGTCAGAACGTCAAGGTGTAA