SecReT6
Effector Protein ID: 378953688
vgrG1a
SecReT6 ID540
T6SS typeA3
Gene symbolvgrG1a
Locus tagPSF113_5807
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6692072..6694009 [+]
Productprotein VgrG1a
Effector typeProtein
Homologous effectorPA0091
Descriptiontype VI secretion system Vgr family protein
UniProt IDG8Q725
KEGG IDpfe:PSF113_5807
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.10E-89, Aligned region: 30..329
Phage_base_V [PF04717], Evalue: 7.80E-26, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 0.0013, Aligned region: 514..536
Protein Sequence: 645 a.a.     [Download]
>gi|378953688|ref|YP_005211176.1| protein VgrG1a [Pseudomonas fluorescens F113]
MLFNQATRLAKITSPLGPEVLLLKDMGGGEELGRLFNYELQLHSLDNAIDLNQVLGKPMCVSLQLDGGGE
RYFHGIVARFSQNVDQGQFASYQATLRPWFWLLTRTSDCRIFQNLTIPQIIKQVFRDLGFSDFEDALSRP
YREWEYCVQYRETSFDFVSRLMEQEGIYYFFRHEQGRHVLVLADAYGAHTTAPGYGSVPYYPKNEQQRER
DHIHDWHLAQEVQPGSLELNDYDFQRPSARIDVRSAMPRPHTAGDYPLYDYPGTYVQSQDGEHYARTRIE
ALQTQHEQVELAGNARGLGSGHLFSLTGFTRQDQNREYLIVGARYYLSQESGETGGGAPTAQFESSLTCI
DAQQSYRPLPITHRPIVKGPQTALVVGPKGEEIWTDQFGRVKVHFYWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPANATQSGMKSRSSKGGTPANFNEIRM
EDKKGAEQLYIHAERNQDIVVEVDESHSVGHDRNKSIGHNETVTIGNNRLRIVKQEDILSVGQRKTDSIS
QSYVIEVGENLRLVCGESILELNASGQINLTGVQISFYASGDAEFNTGGVLHLNNGGGPGATPDGQGVKG
SIDANIQAAFPAPKG
-
Nucleotide Sequence: 1938 bp     [Download]
>gi|378947941|ref|NC_016830.1|:6692072-6694009 Pseudomonas fluorescens F113 chromosome, complete genome
ATGTTATTCAACCAAGCCACCCGCCTGGCCAAGATCACCAGCCCCCTGGGACCTGAGGTACTGCTGCTCA
AGGACATGGGCGGCGGCGAAGAACTGGGGCGGCTGTTCAACTATGAGTTGCAGCTGCACTCGCTGGATAA
CGCCATCGACCTCAATCAGGTGCTCGGCAAGCCCATGTGCGTGAGCCTGCAACTCGATGGCGGTGGCGAG
CGTTATTTCCATGGCATCGTGGCCCGTTTCAGCCAGAACGTCGACCAGGGCCAGTTCGCCAGTTACCAGG
CCACCCTGCGCCCGTGGTTTTGGCTGCTGACCCGTACCTCCGATTGCCGGATTTTCCAGAACCTCACCAT
CCCGCAGATCATCAAGCAGGTGTTCCGCGACTTGGGCTTTTCCGATTTCGAAGACGCCCTGAGCCGGCCT
TATCGCGAGTGGGAATACTGCGTGCAGTATCGCGAGACCAGTTTCGACTTCGTCAGCCGCTTGATGGAGC
AGGAAGGGATCTACTACTTCTTCCGCCATGAGCAAGGTCGACATGTGCTGGTGCTGGCCGACGCTTATGG
AGCCCACACCACGGCGCCCGGCTACGGCTCGGTGCCCTACTACCCCAAGAACGAGCAGCAGCGCGAGCGT
GACCACATACACGACTGGCACCTGGCCCAGGAAGTCCAGCCCGGCTCGCTGGAGCTCAACGACTACGACT
TCCAACGCCCCAGCGCACGCATCGACGTACGCTCGGCCATGCCCCGCCCACACACTGCCGGCGACTATCC
CCTGTACGACTACCCTGGCACCTACGTGCAGAGCCAGGACGGCGAACACTACGCCCGCACCCGCATCGAA
GCCTTGCAGACCCAGCACGAACAGGTCGAGCTGGCCGGTAACGCTCGGGGCCTGGGCTCGGGGCATCTGT
TCAGCCTCACCGGCTTCACCCGCCAGGACCAGAACCGCGAATACCTGATTGTCGGCGCCCGCTACTACCT
CTCCCAGGAAAGCGGCGAAACCGGCGGCGGCGCGCCGACAGCACAGTTCGAAAGCAGCCTGACCTGCATC
GACGCCCAGCAAAGCTATCGGCCGCTGCCCATCACCCATCGCCCTATCGTCAAGGGCCCGCAGACTGCCT
TAGTGGTGGGTCCCAAGGGCGAGGAAATCTGGACCGATCAGTTCGGCCGAGTGAAGGTGCACTTCTATTG
GGATCGGCACGACCAGTCCAACGAAAACAGCTCGTGCTGGATTCGCGTGTCGCAGGCATGGGCCGGGAAA
AACTGGGGCTCGATGCAGATCCCGCGCATTGGCCAGGAAGTGATCGTCAGTTTCCTCGAAGGCGACCCGG
ATCGGCCGATCATCACCGGTCGCGTCTACAATGCCGAACAGACCGTGCCCTATGACTTGCCCGCCAATGC
CACCCAGAGCGGGATGAAAAGCCGTTCGAGCAAGGGCGGCACGCCGGCGAATTTCAACGAAATCCGCATG
GAAGACAAGAAAGGCGCCGAGCAACTGTACATCCACGCCGAGCGTAACCAGGACATCGTGGTCGAGGTGG
ATGAAAGCCACTCGGTGGGCCATGACCGCAACAAGAGCATCGGCCACAACGAGACGGTGACCATCGGCAA
CAACCGCCTGCGCATCGTCAAGCAGGAGGACATCCTCTCCGTCGGCCAGCGCAAGACCGACAGCATCAGC
CAGAGCTACGTGATTGAAGTGGGCGAAAACCTGCGCCTGGTGTGCGGCGAAAGCATCCTGGAGCTCAACG
CCAGCGGCCAGATCAACCTGACCGGCGTACAGATCAGCTTCTACGCCAGCGGCGATGCCGAGTTCAACAC
CGGCGGCGTGCTGCACCTGAACAACGGCGGCGGCCCCGGAGCCACGCCGGACGGCCAGGGCGTCAAGGGC
AGCATCGATGCCAACATCCAAGCCGCGTTCCCTGCACCCAAGGGCTAA