SecReT6
Effector Protein ID: 378958634
-
SecReT6 ID543
T6SS typeA3
Gene symbol-
Locus tagSTBHUCCB_5270
StrainSalmonella enterica subsp. enterica serovar Typhi str. P-stx-12
Repliconchromosome [GenBank: NC_016832] [Browse all T6SS(s) in this replicon]
Location [Strand]562364..562732 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTY2606
DescriptionTae3_TY
UniProt IDH6P0Q6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 9.80E-05, Aligned region: 17..88
NLPC_P60 [PF00877], Evalue: 0.00015, Aligned region: 23..95
Protein Sequence: 122 a.a.     [Download]
>gi|378958634|ref|YP_005216120.1| hypothetical protein STBHUCCB_5270 [Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12]
MSWDKRVAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHAKDYGPMLRSAGFTAIGTYEMPREGD
VIIIQPYAGGNPSGHMAIYDGAEWYSDFKQRDMWAGPGYRAARPSYTIYRKN
-
Nucleotide Sequence: 369 bp     [Download]
>gi|378958130|ref|NC_016832.1|:c562732-562364 Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12 chromosome, complete genome
ATGAGTTGGGATAAAAGAGTGGCGGTTAATTATGCCAAAACGCATGCAGGTTCTCATTCTCAAGGCCGGT
GTGCGGAATTTACCCGAAAGGCAATTCAGGCGGGCGGTATCACGCTGGGGCATACATATCATGCGAAAGA
TTATGGCCCAATGTTAAGAAGCGCCGGATTCACCGCTATTGGTACCTATGAAATGCCGCGCGAGGGTGAC
GTCATCATTATTCAACCTTACGCTGGCGGAAACCCGAGCGGTCACATGGCGATATACGATGGCGCAGAGT
GGTATTCAGATTTTAAACAACGCGATATGTGGGCCGGCCCGGGCTACCGGGCAGCCAGGCCCTCATATAC
CATCTACAGGAAGAATTAA