SecReT6
Effector Protein ID: 378961225
-
SecReT6 ID543
T6SS typeA3
Gene symbol-
Locus tagSTBHUCCB_32180
StrainSalmonella enterica subsp. enterica serovar Typhi str. P-stx-12
Repliconchromosome [GenBank: NC_016832] [Browse all T6SS(s) in this replicon]
Location [Strand]3120957..3121442 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDH6P219
KEGG IDsex:STBHUCCB_32180
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-38, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|378961225|ref|YP_005218711.1| hypothetical protein STBHUCCB_32180 [Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12]
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTKFVDLATPVLN
EYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKPVETMSLNFTKIKWQITAEKS
DGAQQESRASVWDLAMDQIGK
-
Nucleotide Sequence: 486 bp     [Download]
>gi|378958130|ref|NC_016832.1|:c3121442-3120957 Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12 chromosome, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACAATATCAAAGGCGAAAGCCAGGTTGAAGGCTTTGAAGATCAGA
TAGAGATCATGTCTTATAGCCACAATGTGGCAATGCAGGTAAATAACGATGTTAGCCTCACTGAGCGGAC
TTCCGGGCGTGCGCATGTTGGTGAAATGTCGCTCACCAAATTTGTCGACCTCGCCACGCCTGTGCTCAAT
GAGTACTGCTGTAGCGGGAGGCTAATTAGAACCGCGGTGCTGACGTTGTGCCGCAATGACGACGGCAAAA
TGCGGTCGCTTATCGTTTATACCCTGACAAACGTGCTGATATCACAACTCAGTGTTAGCGGCGGCGCCGG
CGGTAAGCCGGTGGAAACGATGTCGCTGAACTTCACGAAAATCAAATGGCAAATCACTGCCGAGAAATCA
GACGGCGCTCAACAGGAGTCCAGAGCGTCAGTATGGGATCTGGCGATGGACCAGATAGGGAAATGA