SecReT6
Effector Protein ID: 378982813
-
SecReT6 ID553
T6SS typeA3
Gene symbol-
Locus tagSTMDT12_C02720
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. T000240
Repliconchromosome [GenBank: NC_016860] [Browse all T6SS(s) in this replicon]
Location [Strand]317684..318169 [+]
Productputative cytoplasmic protein
Effector typeProtein
Homologous effectorSTM0277
DescriptionTae4_TM
UniProt IDU3SDD6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 4.00E-28, Aligned region: 40..141
Protein Sequence: 161 a.a.     [Download]
>gi|378982813|ref|YP_005245968.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240]
MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGGYFQNACPIRMSYVLNATGFPIARNSPYAKVSG
ADNKFYIYRVNDMIDYLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCH
LLNDPDNGPFVPEVGTLWILP
-
Nucleotide Sequence: 486 bp     [Download]
>gi|378982542|ref|NC_016860.1|:317684-318169 Salmonella enterica subsp. enterica serovar Typhimurium str. T000240, complete genome
ATGAACAGACCTTCATTCAATGAAGCGTGGTTAGCTTTTAGGAAGGTGAATCATTCCGTCGCTGATGTGG
GTAGCATTATTGGTGGAAACGTTGGGAAAAATATAACTGGTGGTTATTTTCAAAATGCCTGCCCTATTCG
AATGAGCTATGTTTTGAATGCGACAGGGTTCCCAATAGCCCGTAACTCTCCGTATGCAAAGGTTAGTGGT
GCCGATAATAAATTCTATATTTATCGCGTGAATGATATGATTGATTATCTTACTCATACTATGGGCAAGC
CTGATCTTATTGTTAATAATCCGAAACAGAGTGACTTTATCGGGAAGAAAGGAATTATCGTAGTAAAAGG
GCATGGCTGGAGCAATGCCAGAGGACACGTTACATTATGGAATGGCAGTATCTGTTCAGATCAGTGCCAC
TTATTAAATGACCCAGATAATGGACCATTTGTTCCTGAAGTTGGGACACTGTGGATACTGCCGTGA