SecReT6
Effector Protein ID: 378990449
-
SecReT6 ID554
T6SS typeA3
Gene symbol-
Locus tagSTMUK_3119
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. UK-1
Repliconchromosome [GenBank: NC_016863] [Browse all T6SS(s) in this replicon]
Location [Strand]3256830..3257315 [-]
Productputative cytoplasmic protein
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDF5ZTY4
KEGG IDsej:STMUK_3119
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.20E-38, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|378990449|ref|YP_005253613.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1]
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTKFVDLATPVLN
EYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKPVETMSLNFTKIEWQITAEKS
DGAQQESRTSVWDLAMNQIGK
-
Nucleotide Sequence: 486 bp     [Download]
>gi|378987404|ref|NC_016863.1|:c3257315-3256830 Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1 chromosome, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACAATATCAAAGGCGAAAGCCAGGTTGAAGGCTTTGAAGATCAGA
TAGAGATCATGTCTTATAGCCACAATGTGGCAATGCAGGTAAATAACGATGTTAGCCTCACTGAGCGGAC
TTCCGGGCGCGCGCATGTTGGTGAAATGTCGCTCACCAAATTTGTCGACCTCGCCACGCCTGTGCTCAAT
GAGTACTGCTGTAGCGGGAGGCTAATTAGAACCGCGGTGCTGACGTTGTGCCGCAATGACGACGGCAAAA
TGCGGTCGCTTATCGTTTATACCCTGACAAACGTGCTGATATCACAACTCAGTGTTAGCGGCGGCGCCGG
CGGTAAGCCGGTGGAAACGATGTCGCTGAACTTCACGAAAATCGAATGGCAAATCACTGCCGAGAAATCA
GACGGCGCTCAGCAGGAGTCCAGAACGTCAGTATGGGATCTGGCGATGAACCAGATAGGGAAATGA