SecReT6
Effector Protein ID: 379704340
-
SecReT6 ID547
T6SS typeA2
Gene symbol-
Locus tagRahaq2_4992
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]463340..463831 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDH2J2A9
KEGG IDraq:Rahaq2_4992
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.20E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|379704340|ref|YP_005220714.1| type VI secretion system effector [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQDHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKLVKVAPKMHDIKDPAKEKHNHLEAIELRYE
KITWTYKDGNIIHSDSWNERTTA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|379703932|ref|NC_016835.1|:463340-463831 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGGCAATTCCTGTTTATCTGTGGCTGAAAGACGACGGCGGTGCGGACATTAAAGGTTCCGTAGACGTTA
AAGATCGTGAAGGCAGCATCGAAGTGGTTGCGCAGGATCACAACCTGTATATCCCGACCGATAACAACAC
CGGCAAACTGACGGGTACTCGTATTCACACCCCGTTCCTGTTTACCAAAGAAATCGATTCTTCCAGCCCG
TACCTGTACAAAGCAGTGACCACCGGTCAGACCCTGAAATCTGCTGAGTTCAAATGGTATCGCATCAACG
ACGCAGGCCAGGAAGTTGAGTATTTCAACACCAAACTGGAAAACGTCAAGCTGGTGAAAGTCGCGCCAAA
AATGCACGACATAAAAGATCCGGCTAAAGAGAAACACAACCACCTCGAAGCTATTGAGCTGCGTTACGAA
AAAATCACCTGGACCTACAAAGACGGCAACATCATTCATTCCGATTCGTGGAACGAACGTACCACCGCGT
AA