SecReT6
Effector Protein ID: 383190840
-
SecReT6 ID537
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_3004
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconchromosome [GenBank: NC_016818] [Browse all T6SS(s) in this replicon]
Location [Strand]3230586..3231071 [-]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDH2IUX2
KEGG IDraq:Rahaq2_3004
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-33, Aligned region: 8..144
Protein Sequence: 161 a.a.     [Download]
>gi|383190840|ref|YP_005200968.1| type VI secretion system effector [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MAVPVHLWLKDDGGANIRGSSDVKNREGSIELRSIHHNLSIPTDSNTGKLTGTRQHAPFQFDKEIDSSSP
YLYKAVGTGQTLHSAEIKWYCINDAGQEVEYFNILLETVKVISVTPMMHDTRGCPGTGHMENVALRYEKI
TWKYVDGNIQYTDAWNERSTA
-
Nucleotide Sequence: 486 bp     [Download]
>gi|383187966|ref|NC_016818.1|:c3231071-3230586 Rahnella aquatilis CIP 78.65 = ATCC 33071 chromosome, complete genome
ATGGCTGTACCAGTTCACTTATGGCTTAAGGACGATGGCGGTGCAAATATCCGTGGTTCATCTGATGTAA
AGAATCGTGAAGGAAGCATAGAACTAAGATCGATTCACCATAACCTGAGTATCCCAACTGATAGCAACAC
AGGGAAGCTAACAGGCACTCGACAACATGCCCCTTTCCAGTTTGATAAGGAAATCGACTCATCAAGTCCT
TACTTATACAAGGCAGTGGGTACAGGTCAAACGTTACACTCTGCCGAAATCAAATGGTATTGCATCAACG
ATGCAGGGCAGGAAGTCGAGTACTTCAACATTTTGCTTGAAACCGTAAAGGTCATTTCAGTAACTCCAAT
GATGCACGATACCCGTGGCTGTCCTGGCACAGGCCATATGGAAAATGTTGCACTTCGTTATGAGAAAATC
ACCTGGAAGTATGTTGATGGCAATATTCAATATACCGATGCCTGGAACGAACGAAGTACGGCATAA