SecReT6
Effector Protein ID: 383191373
-
SecReT6 ID537
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_3564
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconchromosome [GenBank: NC_016818] [Browse all T6SS(s) in this replicon]
Location [Strand]3773738..3774223 [-]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDH2J0B8
KEGG IDraq:Rahaq2_3564
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.50E-34, Aligned region: 6..146
Protein Sequence: 161 a.a.     [Download]
>gi|383191373|ref|YP_005201501.1| type VI secretion system effector [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MAIPAYLWLKDDGGADIKGSVDVNNREGSIEVTGFSHNLRLPTDPLTGSITATRNHSAMIFQKEFDSSSP
YLYKAVSKGQTLKSAEFKWYHINDAGQEVEYFNMFIEGVKVVSISPLMHDIKDPTKEKHNHLEVVELRYD
KITWKHCDGNIMFTDSWNERA
-
Nucleotide Sequence: 486 bp     [Download]
>gi|383187966|ref|NC_016818.1|:c3774223-3773738 Rahnella aquatilis CIP 78.65 = ATCC 33071 chromosome, complete genome
ATGGCAATTCCAGCTTATTTATGGTTGAAAGATGACGGCGGTGCGGACATCAAAGGGTCTGTGGATGTAA
ATAATAGAGAAGGTAGTATTGAGGTCACAGGGTTTTCACATAATTTACGATTGCCAACAGACCCTTTAAC
CGGAAGCATTACAGCAACGCGTAATCATTCTGCGATGATTTTCCAAAAAGAATTTGATTCATCATCACCT
TATTTATATAAAGCGGTTTCAAAAGGCCAAACTTTAAAGTCAGCAGAATTTAAATGGTATCATATCAATG
ATGCAGGGCAAGAAGTTGAGTACTTCAATATGTTTATCGAAGGCGTTAAGGTTGTGAGCATTTCCCCGCT
GATGCATGATATTAAAGATCCAACCAAAGAAAAACACAATCATCTTGAAGTTGTTGAACTCCGTTACGAC
AAAATAACGTGGAAACATTGCGATGGGAACATCATGTTCACAGACTCATGGAATGAAAGGGCGTAA